y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna16457.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 451 Molecular Weight: 50677.4 Isoelectric Point: 5.4853
ChromosomeChromosome/Scaffold: 1 Start: 19410142 End: 19411534
DescriptionUDP-glucose:flavonoid 3-o-glucosyltransferase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12314251.2e-21
  DYLEEQMKKPVILAGPVVPDPPSSALEERWAEWLGGESVLKKEQLQELVLGIELTGLPFFAALKTPVGYESIEAALPEGFEERVKGRGVVYSGWVQQPLI
  LNHPSVGCFVTHCGSGSLAEAMMNHCRLVLLPHVGDQIINARMMGGDLRGGVEVEKGDEDDLFSKEGVCKAVEAVMDDKSEVGKEVKANHAKWRE
Full Sequence
Protein Sequence     Length: 451     Download
MSSHDRKSLH IVMYPWFAMG HLSTFLHISN KLAERGHRIS FFLPQKTEAK LQDYNLHPDL    60
ITFYPLTIPR VEGLPDGAET TADVPFPLRG LIATGMDLTR PQIEKLLREL KPDLVFYDFS    120
HWLPQLLREL DGNIKSVLYC IISPVTIGYL LSPERKLTEK PLVATDLLEA PSSFPSSIIK    180
LRTHEARGLT YMTNREYGPG VTYLERQLTS LCECDAIAFK TCREFEGKFC DYLEEQMKKP    240
VILAGPVVPD PPSSALEERW AEWLGGESVL KKEQLQELVL GIELTGLPFF AALKTPVGYE    300
SIEAALPEGF EERVKGRGVV YSGWVQQPLI LNHPSVGCFV THCGSGSLAE AMMNHCRLVL    360
LPHVGDQIIN ARMMGGDLRG GVEVEKGDED DLFSKEGVCK AVEAVMDDKS EVGKEVKANH    420
AKWREFFSNK ELEKTYIDGF EQRLHQLLEC *                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028638.0e-3310443467+
PLN02670PLN026707.0e-765439464+
PLN00414PLN004148.0e-1369444452+
PLN02764PLN027644.0e-1469448457+
PLN02208PLN022082.0e-1466448460+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A3e-18213425206444B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2vch_A3e-18213425206444B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB2vce_A3e-18213425206444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A0.000000000000002281425295427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A0.000000000000002281425295427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)