y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna16720.1-v1.0-hybrid
FamilyGT41
Protein PropertiesLength: 972 Molecular Weight: 109588 Isoelectric Point: 6.7807
ChromosomeChromosome/Scaffold: 6 Start: 1052568 End: 1060675
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT415517390
  RKYAAQCSIIASRFGLPAFNHPAPIPIKRNGGFERLRVGYVSSDFGNHPLSHLMGSVFGMHNKENVEVFCYALSPNDGTEWRQRTQSEAEHFVDVSAMTS
  DVIAKMINEDNIQILINLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGANYIDYLVTDEFVSPLRYSHIYSEKLVHLPHCYFVNDYKQ
GT417539520
  RLDYGLPEDKFIFATFNQLYKMDPEIFNTWCNILKRVPNSALWLLRFPAAGEMRLRAYAAAQGVQADQIIFTDVAMKGEHIRRSALADLFLDTPLCNAHT
  TGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVNSMKEYEEKAVSLALNPPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSG
Full Sequence
Protein Sequence     Length: 972     Download
MMTVHGEARP ARAQFGVESF KPEPSSLSLV SFKPPENHEV DEDAHLALAH QMYKAGNYKE    60
ALEHSSIVYE RNPIRTDNLL LLGAIYYQLH EFDMCIAKNE EALRIEPHFA ECYGNMANAW    120
KEKGNSDLAI RYYLIAIELR PNFCDAWSNL ASAYMRKGRL EEAAQCCRQA LQLNPHLVDA    180
HSNLGNLMKA RGLVQEAYSC YLEALRIQPN FAIAWSNLAG LFMESGDLNR ALQYYKEAVK    240
LKPAFPDAYL NLGNVYKALG LPQEAIVCYQ RALQTRPNYA MAYGNLASTY YEQGQLELAV    300
LHYKQAIVCD PRFLEAYNNL GNALKDVGRV DEAIQCYNQC LTLQPNHPQA LTNLGNIYME    360
WCVILKNMVP AAASYYKATL TVTTGLSAPF NNLAIIYKQQ GNYADAISCY NEVLRIDPLA    420
ADGLVNRGNT YKEIGRVSEA IQDYIHAISV RPTMAEAHAN LASAYKDSGH VEAAIKSYKQ    480
ALHLRPDFPE ATCNLLHTLQ CVCSWEDRDK MFAEVEGIIR RQINMSLLPS VQPFHAIAYP    540
IDSLLALDIS RKYAAQCSII ASRFGLPAFN HPAPIPIKRN GGFERLRVGY VSSDFGNHPL    600
SHLMGSVFGM HNKENVEVFC YALSPNDGTE WRQRTQSEAE HFVDVSAMTS DVIAKMINED    660
NIQILINLNG YTKGARNEIF AMQPAPIQVS YMGFPGTTGA NYIDYLVTDE FVSPLRYSHI    720
YSEKLVHLPH CYFVNDYKQK NQDVLDPNCR HRRLDYGLPE DKFIFATFNQ LYKMDPEIFN    780
TWCNILKRVP NSALWLLRFP AAGEMRLRAY AAAQGVQADQ IIFTDVAMKG EHIRRSALAD    840
LFLDTPLCNA HTTGTDVLWA GLPMVTLPLE KMATRVAGSL CLATGLGDEM IVNSMKEYEE    900
KAVSLALNPP KLQALTNKLK AVRMTCPLFD TARWVRNLER SYFKMWNLHC SGQRPQHFKV    960
AENDSDFPYD R*                                                        1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3914Spy0.008124229113+
COG3914Spy6.0e-99391947569+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03457376390A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine
PDB4gz6_D0753958514718A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine
PDB4gz6_D2e-291072546153A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine
PDB4gz6_D1e-271753276158A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine
PDB4gz6_D2e-261412876152A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)