y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna17328.1-v1.0-hybrid
FamilyGT13
Protein PropertiesLength: 489 Molecular Weight: 55825.1 Isoelectric Point: 7.2332
ChromosomeChromosome/Scaffold: 2 Start: 10117795 End: 10123291
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13664800
  IQIRLFATQSQYADRLADAIESENQCTSQLRSLIDQISLQQGQIETMKDSIVEQKEQLEQECGQLKALVQELERKDVERLTNKEQAPVAAVVIMACNRAD
  YLERTIKSILKYQSSVATKFPLFVSQDGSHPGVKDKALSYDQLTYMQLHGYIPVCLGHYKWALDGLFYKHKFNRVIILEDDMEIAPDFFDYFEAAADLLD
  KDKSIMAVSSWNDNGQKQFVYDPEVLYRSDFFPGLGWMLSRSTWDELSPKWPKAYPCYKRITKVDNFFVQKCAEHITLGNMYAFLPSLSHLTSQGSSLGQ
  FYKQYLEPIKLNDVPVDWKSMDLSYLMEDKYIKHFAEIVKKAKPVHGADLVLKARNIAVDVRIPYNNQPDFERIANEFGIFEEWKDGIPRTAYKGVVVFR
  HQNRQRIFLVGPGSL
Full Sequence
Protein Sequence     Length: 489     Download
MKKTGVLLAK QSTRIAAGSV PDSNPTRLAQ LVGLNSPRSE LPNVMKNFLC DFRFLLLLAA    60
AAFIYIQIRL FATQSQYADR LADAIESENQ CTSQLRSLID QISLQQGQIE TMKDSIVEQK    120
EQLEQECGQL KALVQELERK DVERLTNKEQ APVAAVVIMA CNRADYLERT IKSILKYQSS    180
VATKFPLFVS QDGSHPGVKD KALSYDQLTY MQLHGYIPVC LGHYKWALDG LFYKHKFNRV    240
IILEDDMEIA PDFFDYFEAA ADLLDKDKSI MAVSSWNDNG QKQFVYDPEV LYRSDFFPGL    300
GWMLSRSTWD ELSPKWPKAY PCYKRITKVD NFFVQKCAEH ITLGNMYAFL PSLSHLTSQG    360
SSLGQFYKQY LEPIKLNDVP VDWKSMDLSY LMEDKYIKHF AEIVKKAKPV HGADLVLKAR    420
NIAVDVRIPY NNQPDFERIA NEFGIFEEWK DGIPRTAYKG VVVFRHQNRQ RIFLVGPGSL    480
 KQLGIDDS*                                                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4942COG49420.0086515086+
cd00761Glyco_tranf_GTA_type2.0e-8156303148+
cd02514GT13_GLCNAC-TI1.0e-128153477351+
pfam03071GNT-I1.0e-17963487446+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01494774337A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01494774337A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2apc_A01534772331A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am5_A01534772331A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am4_A01534772331A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
Transmembrane Domains
StartEnd
5471
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny