y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna17436.1-v1.0-hybrid
FamilyCBM43
Protein PropertiesLength: 427 Molecular Weight: 47011.1 Isoelectric Point: 9.5976
ChromosomeChromosome/Scaffold: 2 Start: 11056111 End: 11057558
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17261007.1e-23
  VGVNYGQLGNNLPTPPQSVKLIQKLKAKRVKLYDATPKILEALRNTDIEVCIMVPNDLINNISSNQTLANQWDKS
CBM433474258.5e-27
  WCVVKEGANKTAVAEALSDVCSQGNKTCDPIRPGGKCFKPNKLAQHASYAFSAYWAQFRKAEKACYFGGVAAQTIKDPS
GH171013200
  VYPNLVPAMRKMKLALKTHGITKVKVGTPSATDVLDSIAFPPSNGTFRSDISSSVIRPMLKFLSKTKSFFVDVYTFFPWASDPTRIDLDYALFASTKVRH
  TDPVTGLTYHNLFDQMVDTLIFAMKRLGYPDIPIWIAETGWPSAGDYDQIGANLHNAATYNRNVIKKFTAKPPIGTPARPGVVLPSFIFALYNENTKRGQ
  TTERNFGLLWPNGTHVYEID
Full Sequence
Protein Sequence     Length: 427     Download
MELGLAPLLL LCFFLSISSA EFSANVGVNY GQLGNNLPTP PQSVKLIQKL KAKRVKLYDA    60
TPKILEALRN TDIEVCIMVP NDLINNISSN QTLANQWDKS VYPNLVPAMR KMKLALKTHG    120
ITKVKVGTPS ATDVLDSIAF PPSNGTFRSD ISSSVIRPML KFLSKTKSFF VDVYTFFPWA    180
SDPTRIDLDY ALFASTKVRH TDPVTGLTYH NLFDQMVDTL IFAMKRLGYP DIPIWIAETG    240
WPSAGDYDQI GANLHNAATY NRNVIKKFTA KPPIGTPARP GVVLPSFIFA LYNENTKRGQ    300
TTERNFGLLW PNGTHVYEID LTGKTPESEF KALPPAKNNK AYPGPIWCVV KEGANKTAVA    360
EALSDVCSQG NKTCDPIRPG GKCFKPNKLA QHASYAFSAY WAQFRKAEKA CYFGGVAAQT    420
IKDPSE*                                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X89.0e-1834741776+
smart00768X86.0e-2934742579+
pfam00332Glyco_hydro_174.0e-8626320322+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0263211312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A1.4013e-45263211306A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B1.4013e-45263211306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A1.4013e-45263211306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1ghs_B7.9874e-44263211306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Signal Peptide
Cleavage Site
20
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)