y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna17437.1-v1.0-hybrid
FamilyCBM43
Protein PropertiesLength: 563 Molecular Weight: 62200.6 Isoelectric Point: 9.3537
ChromosomeChromosome/Scaffold: 2 Start: 11074185 End: 11081292
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM434835611.8e-28
  WCLVKEGANKTAVAEALSYACSQGNKTCDPIQPGGKCFKPNTLAQHASYAFSAYWAQFRKAGGSCSFGGLAVQTIKDPS
GH171354560
  VGVNYGQLGNNLPSPSESVKLIQNLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLANQWVHANVVPFYPHTLIRYLLVGNEILSAPD
  KSIWFNLVPAMRKIKKALKIHGITKVKVGTPSAMDVLESSFPPSNGTFRSDISSSVIKPMLKFLFKTKSFFFVDVYPFFPWASDPTHIDLDYALLEFTNI
  TYTDPVSGLTYHNLFDQMVDALIFAMKRRGYPDIRVWIAETGWPSGGDYDQIGTNIHNAATYNRNVIKKFTAKPPVGTPARPGVVLPSFIFALYNENMKP
  GPGTERNFGLLYPNGSNVYEID
Full Sequence
Protein Sequence     Length: 563     Download
MSNPKPRGEA WKNPEDVSLC MAVVAVGEDG DKATGQEKKK LWDRIWEVYE ACKPPSFVIR    60
SGGGCEARWR KIRPGCTKWR KALTKAEAAH ANGENVTDLP QSPFDQIRTM ELGLVPLLLL    120
CFFISISSAE FSAKVGVNYG QLGNNLPSPS ESVKLIQNLK AKRVKIYDAN PKILEALRNT    180
DLQVSMMVPN ELINNISSNQ TLANQWVHAN VVPFYPHTLI RYLLVGNEIL SAPDKSIWFN    240
LVPAMRKIKK ALKIHGITKV KVGTPSAMDV LESSFPPSNG TFRSDISSSV IKPMLKFLFK    300
TKSFFFVDVY PFFPWASDPT HIDLDYALLE FTNITYTDPV SGLTYHNLFD QMVDALIFAM    360
KRRGYPDIRV WIAETGWPSG GDYDQIGTNI HNAATYNRNV IKKFTAKPPV GTPARPGVVL    420
PSFIFALYNE NMKPGPGTER NFGLLYPNGS NVYEIDLTGK TPVLEFKPLP PATNNKPYPG    480
PIWCLVKEGA NKTAVAEALS YACSQGNKTC DPIQPGGKCF KPNTLAQHAS YAFSAYWAQF    540
RKAGGSCSFG GLAVQTIKDP SE*                                            600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X82.0e-2048355477+
smart00768X81.0e-3248356179+
pfam00332Glyco_hydro_171.0e-106135456323+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A01354571312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B01354571306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A01354571306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_D01344581316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_C01344581316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)