y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna17551.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 761 Molecular Weight: 82576.3 Isoelectric Point: 7.3236
ChromosomeChromosome/Scaffold: 2 Start: 12003929 End: 12018194
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12886890
  TRGDVQPFIAIGKRLQDYGHRVRLATHSNFKEFVLTAGLEFYPLGGDPKILAGYMVKNKGFLPSGPSEIPIQRNQIKEIIYSLLPACKDPDLDSGILFKA
  DAIIANPPAYGHTHVAEALKIPLHIFFTMPWTPTSEFPHPLSRVKQQTGYRLSYQIVDSLIWLGIRDMINDVRKKRLNLRPVTYLSGSQGSESDVPHGYI
  WSPHLVPKPKDWGPKVDVVGFCFLDLASNYQPPEPLVKWLEAGDKPIYIGFGSLPVQEPQKMTQIIVEALEQTGQRGIINKGWGGLGDLAEPKDSIYLLD
  NCPHDWLFLHCKAVVHHGGAGTTAAGLKAACPTTIVPFFGDQPFWGERVHARGVGPAPIAVDEFSLPKLVAAINYMLDPKVKERAIELAKDMENEDGVTG
  AV
Full Sequence
Protein Sequence     Length: 761     Download
MLVPLDVGLV KALRCAQQLG LRPSATTKGV PLRGSGVSPP YLARGLGHPW SGDRFLISGV    60
RRMRTLGPTF SLWGEINPKP LSSSRFASDL DQDRPRGPEQ AAVMAENRRS SSESSVEVSL    120
AIEREIDGGS GRISVELENG QASGGGGGVS APVTNGSSAG HSGSSDFSFS KANPAEISPT    180
NEKPVQHSVP VKLERSKTES TRPSVLSKEA AKIFDNKIPV QQKLKLLNRI ATVKDDGTVE    240
FDVPGDIEAQ SFGVGTISGS TDVADETLDA TDLQCIPPMQ IVMLIVGTRG DVQPFIAIGK    300
RLQDYGHRVR LATHSNFKEF VLTAGLEFYP LGGDPKILAG YMVKNKGFLP SGPSEIPIQR    360
NQIKEIIYSL LPACKDPDLD SGILFKADAI IANPPAYGHT HVAEALKIPL HIFFTMPWTP    420
TSEFPHPLSR VKQQTGYRLS YQIVDSLIWL GIRDMINDVR KKRLNLRPVT YLSGSQGSES    480
DVPHGYIWSP HLVPKPKDWG PKVDVVGFCF LDLASNYQPP EPLVKWLEAG DKPIYIGFGS    540
LPVQEPQKMT QIIVEALEQT GQRGIINKGW GGLGDLAEPK DSIYLLDNCP HDWLFLHCKA    600
VVHHGGAGTT AAGLKAACPT TIVPFFGDQP FWGERVHARG VGPAPIAVDE FSLPKLVAAI    660
NYMLDPKVKE RAIELAKDME NEDGVTGAVM AFFKHLPPKK PESEPETTSS GLFSINSKLC    720
SSTASGFDHH KQMSTERMAW RDIGHCQQRF PAAERAPPVN *                        780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1819COG18191.0e-32278686420+
pfam03033Glyco_transf_284.0e-36281425145+
cd03784GT1_Gtf_like2.0e-117279689411+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030259lipid glycosylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3h4t_A1e-302796961381A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB3h4i_A1e-302796961381A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products
PDB1rrv_B2e-232796841387A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1rrv_A2e-232796841387A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1pnv_B4e-212797011392A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00218.3Aquca_034_00218.2Aquca_034_00218.1Aquca_023_00154.1Aquca_034_00218.4
Aquca_023_00154.3Aquca_023_00154.2Aquca_114_00011.1Aquca_114_00011.2
Arabidopsis lyrata896855473768910517
Arabidopsis thalianaAT3G07020.2AT3G07020.1AT1G43620.3AT1G43620.2AT1G43620.1
AT5G24750.1
Brachypodium distachyonBradi5g01230.1Bradi2g56102.1Bradi3g07997.4Bradi3g07997.3Bradi3g07997.2
Brassica rapaBra001229Bra040355Bra029615Bra020468
Carica papayaevm.model.supercontig_8.181evm.model.supercontig_21.209
Capsella rubellaCarubv10013188mCarubv10013187mCarubv10008593mCarubv10002561m
Chlamydomonas reinhardtiiCre07.g333450.t1.2
Citrus clementinaCiclev10020154mCiclev10011454mCiclev10000559mCiclev10000975m
Citrus sinensisorange1.1g013358morange1.1g006412morange1.1g008369morange1.1g013835morange1.1g047047m
Cucumis sativusCucsa.078450.1Cucsa.140330.2Cucsa.140330.1Cucsa.356970.2Cucsa.078450.2
Cucsa.363720.1
Eucalyptus grandisEucgr.H00810.1Eucgr.B01378.1Eucgr.F02699.1Eucgr.H01372.1Eucgr.B01630.1
Eucgr.F02699.2Eucgr.H01372.2Eucgr.G00612.3Eucgr.G00612.1Eucgr.G00612.2
Fragaria vescamrna16762.1-v1.0-hybridmrna08139.1-v1.0-hybrid
Glycine maxGlyma03g19751.1Glyma18g28130.2Glyma18g28130.1Glyma18g47490.2Glyma18g47490.1
Glyma02g08940.1Glyma10g36850.2Glyma20g30760.2Glyma20g30760.4Glyma20g30760.3
Glyma09g38830.2Glyma20g30760.6Glyma20g30760.5Glyma02g08940.2Glyma08g19700.2
Gossypium raimondiiGorai.001G184700.2Gorai.001G184700.10Gorai.001G184700.1Gorai.004G058300.2Gorai.004G058300.1
Gorai.004G261100.2Gorai.004G261100.1Gorai.009G254800.4Gorai.009G254800.3Gorai.009G254800.2
Gorai.009G254800.1Gorai.001G184700.3Gorai.009G254800.5Gorai.001G184700.4Gorai.001G184700.5
Gorai.001G184700.7Gorai.001G184700.6Gorai.001G184700.8Gorai.004G261100.3Gorai.008G041600.1
Linum usitatissimumLus10020382Lus10011882Lus10024544Lus10022815Lus10018878
Lus10009556Lus10028572Lus10011883Lus10020381Lus10009557
Malus domesticaMDP0000304346MDP0000278182MDP0000175609MDP0000304996MDP0000152076
MDP0000243097MDP0000771934MDP0000895000
Manihot esculentacassava4.1_004218mcassava4.1_003877mcassava4.1_025328mcassava4.1_014281m
Medicago truncatulaMedtr4g022580.1Medtr7g079430.1Medtr1g098640.2Medtr1g098640.1Medtr1g098640.3
Medtr4g022610.1
Mimulus guttatusmgv1a002910mmgv1a003019mmgv1a022288mmgv1a023756mmgv1a010079m
mgv1a004761mmgv1a005156m
Oryza sativaLOC_Os07g23740.3LOC_Os07g23740.2LOC_Os07g23740.1LOC_Os04g04254.2LOC_Os04g04254.1
LOC_Os01g64750.1LOC_Os04g04240.1LOC_Os02g11940.1
Panicum virgatumPavirv00030954mPavirv00043473mPavirv00043474mPavirv00048943mPavirv00056277m
Pavirv00034065mPavirv00051133m
Physcomitrella patensPp1s90_132V6.1Pp1s245_59V6.1Pp1s110_116V6.1Pp1s159_62V6.1Pp1s281_20V6.1
Pp1s131_65V6.1
Phaseolus vulgarisPhvul.008G056500.2Phvul.008G056500.1Phvul.010G013800.1Phvul.007G080800.1Phvul.004G093900.3
Phvul.004G093900.2Phvul.004G093900.1Phvul.006G212700.1
Picea abiesMA_84359g0010
Populus trichocarpaPotri.014G178300.1Potri.002G067100.1Potri.002G238600.4Potri.002G238600.2Potri.002G238600.1
Potri.002G067100.2Potri.005G193100.1Potri.002G238600.3Potri.003G021100.2Potri.003G021100.1
Prunus persicappa019814mppa002976mppa002535mppa005311m
Ricinus communis30204.m00179130128.m00900929863.m00104933210.m00003430116.m000381
Setaria italicaSi029583mSi009641mSi009639mSi017298m
Selaginella moellendorffii11051343056026840374515406232
Sorghum bicolorSb06g001270.1Sb03g040980.1Sb06g001270.2Sb02g010030.1Sb04g007366.1
Thellungiella halophilaThhalv10020288mThhalv10005442mThhalv10004004m
Vitis viniferaGSVIVT01028556001GSVIVT01034544001GSVIVT01019162001GSVIVT01023003001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)