y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna17622.1-v1.0-hybrid
FamilyAA1
Protein PropertiesLength: 519 Molecular Weight: 58024.6 Isoelectric Point: 5.0274
ChromosomeChromosome/Scaffold: 2 Start: 11621389 End: 11625426
Descriptionlaccase 14
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA12884803e-40
  MFITASMNSLYCEDSGFLSCTEIPVASSVNNISWVNPRSTDLLQAYYRNISGIYSTDFPDQPPTYYNFTEATYSKDTMLTVQGTKVKVLSYNESVEIVFQ
  GTDVQGGSVNHPLHMHGYKFSVVGYGFGNYDNETDPKGFNLVDPPHVTTFGVPKNGWLAIRFVANNPGVWFWHCHMERHLTLGMEAAFIVKNG
Full Sequence
Protein Sequence     Length: 519     Download
MAIMVVHFLV LQFLMISLVR AEVREKNFPR LCETKSVLLV NDIFPGPEIR VHNGDTVYVN    60
VHNQGYYGLT IHWHGIMQLR NPWSDGPEYI TQCPIQPGTN FTYDVLLSTE EGTVWWHAHS    120
DWTRASVHGA IVILPTVGST YPFPQPDKDE VIILSSWYLG DLKARVDEAM EEGTSLHHSD    180
AYTINGQPGD LCPCSKFAQH NLIVVGLDGS YTKPIYTPYI LISPGQTMDV LLKADQALGF    240
YYMAGRHFSS DNAKVTEFDH VNVTAILEYN GNYTYSASPL FPQTLPIMFI TASMNSLYCE    300
DSGFLSCTEI PVASSVNNIS WVNPRSTDLL QAYYRNISGI YSTDFPDQPP TYYNFTEATY    360
SKDTMLTVQG TKVKVLSYNE SVEIVFQGTD VQGGSVNHPL HMHGYKFSVV GYGFGNYDNE    420
TDPKGFNLVD PPHVTTFGVP KNGWLAIRFV ANNPGVWFWH CHMERHLTLG MEAAFIVKNG    480
DTAVTSILEP PAYMPSCDVP LASPIKDSDE FVEKKIDQ*                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_31.0e-4422135116+
PLN02191PLN021912.0e-4922476543+
TIGR03388ascorbase6.0e-6332475517+
PLN02604PLN026043.0e-631475560+
TIGR03389laccase023497539+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B8.96831e-443247519521A Chain A, Crystal Structure (Monoclinic) Of Bee Venom Hyaluronidase
PDB1asq_A8.96831e-443247519521A Chain A, Crystal Structure (Monoclinic) Of Bee Venom Hyaluronidase
PDB1asp_B8.96831e-443247519521A Chain A, Crystal Structure (Monoclinic) Of Bee Venom Hyaluronidase
PDB1asp_A8.96831e-443247519521A Chain A, Crystal Structure (Monoclinic) Of Bee Venom Hyaluronidase
PDB1aso_B8.96831e-443247519521A Chain A, Crystal Structure (Monoclinic) Of Bee Venom Hyaluronidase
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00805.1
Brassica rapaBra005698.306.628Bra005698.306.628
Capsella rubellaCarubv10002796m
Citrus sinensisorange1.1g016876m
Eucalyptus grandisEucgr.B00926.1Eucgr.L00618.1Eucgr.C03119.1Eucgr.D00739.2Eucgr.D00739.1
Eucgr.C04047.1Eucgr.F02651.1Eucgr.E04215.1
Fragaria vescamrna20734.1-v1.0-hybrid.267.525mrna20734.1-v1.0-hybrid.267.525
Linum usitatissimumLus10042249Lus10026401Lus10006157.329.565Lus10006157.329.565
Malus domesticaMDP0000478260MDP0000126274.271.513MDP0000126274.271.513MDP0000192322.262.504MDP0000192322.262.504
MDP0000226556.262.504MDP0000226556.262.504MDP0000139079MDP0000258933.740.941MDP0000258933.740.941
Manihot esculentacassava4.1_011108mcassava4.1_012403m
Medicago truncatulaMedtr3g071890.2
Oryza sativaLOC_Os10g30140.1LOC_Os01g27700.1LOC_Os03g18640.1
Panicum virgatumPavirv00067346m.355.586Pavirv00011031mPavirv00044566mPavirv00002879mPavirv00051916m
Pavirv00063725mPavirv00032843mPavirv00067346m.355.586Pavirv00051097m
Picea abiesMA_97119g0020MA_63042g0010MA_10191230g0010MA_7035458g0010MA_812936g0010
MA_115131g0010MA_8558020g0010MA_73829g0020MA_945295g0010MA_775445g0010
MA_21316g0010.255.559MA_21316g0010.255.559MA_8210355g0010
Populus trichocarpaPotri.013G152700.3
Ricinus communis28644.m000936
Setaria italicaSi034761m.360.589Si034761m.360.589
Sorghum bicolorSb08g000720.1
Vitis viniferaGSVIVT01034822001.347.597GSVIVT01034822001.347.597GSVIVT01012745001GSVIVT01034820001GSVIVT01012746001
GSVIVT01034822001.12.242GSVIVT01034822001.12.242GSVIVT01034833001GSVIVT01013687001.88.319GSVIVT01013687001.88.319
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny