y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna17951.1-v1.0-hybrid
FamilyGH51
Protein PropertiesLength: 766 Molecular Weight: 83792.9 Isoelectric Point: 4.7776
ChromosomeChromosome/Scaffold: 6 Start: 16217405 End: 16226850
Descriptionalpha-L-arabinofuranosidase 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512257450
  FDQVSAMPLDTYKGHGFRKDLVDMLADMKPQFLRFPGGCFVEGEWLRNAFRWKETIGQWEERPGHFGDVWMYWTDDGLGYFEFLQLAEDLGTQPIWVFNN
  GISHNDQVDTSNILPFVQEALDGIEFATGSPDSTWGSIRAAMGHPEPFDLRYVAVGNEDCGKKNYRGGMWVVLQDLRTTEQGQMLPSRRRSEIEQNLWMN
  YIVSDIVLKNSALPEIVGNRNYLKFYSAIKRAYPDIQIISNCDGSSHPLDHPADLYDFHVMFFVPELVYTSASNMFSMAHQFDRTPRKGPKAFVSEYAVT
  GKDAGGGSLLAALAEAGFLIGLEKNSDVVEMASYAPLFVNANNKRESSGATIFNATLQTESSTSLLASAILWKSSEDQKTYLRIKDGFRFCMVSRGVDPM
  RKVCPAELEGQVITPVQLFADQMPIFIQLGFSLAGSGLRNSWTWIVNFGSNIVNLRIRVDGLEPNSVSMSGSTKTVLTSKNVMDENSFDEPKKVIPNLGL
  LENAGEEMDVGLSAHSFTSID
Full Sequence
Protein Sequence     Length: 766     Download
MGVLDVLLCC CCCLVLPCFA VEAQTAQLIV DASQASGRPI SPTLFGLFFE EINHAGAGGL    60
WAELVNNRGP SLSSGFEAGG PNTPSNIDPW SIIGSESSLL VSTDRSSCFE RNKVALRMEV    120
LCDSQGANIC PAGGVGIYNP GFWGMNVEKG KTYSVTLYVR SSGAINVSVS LTSSNGLQTL    180
AAENIMASVS EVSNWTKFNV LLVAKGTNPS SRLQLTTTRK GLIWFDQVSA MPLDTYKGHG    240
FRKDLVDMLA DMKPQFLRFP GGCFVEGEWL RNAFRWKETI GQWEERPGHF GDVWMYWTDD    300
GLGYFEFLQL AEDLGTQPIW VFNNGISHND QVDTSNILPF VQEALDGIEF ATGSPDSTWG    360
SIRAAMGHPE PFDLRYVAVG NEDCGKKNYR GGMWVVLQDL RTTEQGQMLP SRRRSEIEQN    420
LWMNYIVSDI VLKNSALPEI VGNRNYLKFY SAIKRAYPDI QIISNCDGSS HPLDHPADLY    480
DFHVMFFVPE LVYTSASNMF SMAHQFDRTP RKGPKAFVSE YAVTGKDAGG GSLLAALAEA    540
GFLIGLEKNS DVVEMASYAP LFVNANNKRE SSGATIFNAT LQTESSTSLL ASAILWKSSE    600
DQKTYLRIKD GFRFCMVSRG VDPMRKVCPA ELEGQVITPV QLFADQMPIF IQLGFSLAGS    660
GLRNSWTWIV NFGSNIVNLR IRVDGLEPNS VSMSGSTKTV LTSKNVMDEN SFDEPKKVIP    720
NLGLLENAGE EMDVGLSAHS FTSIDLLVEP SHLTTGADSS SISSS*                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart00813Alpha-L-AF_C0.000254760987+
pfam06964Alpha-L-AF_C5.0e-866974074+
smart00813Alpha-L-AF_C3.0e-966974074+
COG3534AbfA8.0e-30240387153+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L0.00000000000000924056548330A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K0.00000000000000924056548330A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J0.00000000000000924056548330A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I0.00000000000000924056548330A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H0.00000000000000924056548330A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Signal Peptide
Cleavage Site
20
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)