y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna18037.1-v1.0-hybrid
FamilyAA7
Protein PropertiesLength: 559 Molecular Weight: 61311.6 Isoelectric Point: 6.6494
ChromosomeChromosome/Scaffold: 6 Start: 17709032 End: 17715990
DescriptionFAD-linked oxidases family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71353301e-25
  NIPDLVVFARSEEEVCKIVKLCDKHKVPIVPYGGATSIEGHTLSPHGGVCIDMSSMKNVKALHVEDMDVVVEPGIGWMELNEYLEPYGLFFPLDPGPGAT
  IGGMCATRCSGSLAVRYGTMRDNVISLKAVLANGEVVKTASRARKSAAGYDLTRLMIGSEGTLGVITEVTLRLQKIPKYSVVAMCNFPSIKDAADV
Full Sequence
Protein Sequence     Length: 559     Download
MAMSSWFSRL RHSSKSLLTI STPHFLRSSS TNLLKTSTTN SGSSKTPFPF WSLPIAVAVS    60
AAAGSLALYP QSNLPRCEPP NPNSRTEFVV KGSHKPVPQE LVNELKAFCK DNMTMDYEER    120
YNHGKPLNSF HKAVNIPDLV VFARSEEEVC KIVKLCDKHK VPIVPYGGAT SIEGHTLSPH    180
GGVCIDMSSM KNVKALHVED MDVVVEPGIG WMELNEYLEP YGLFFPLDPG PGATIGGMCA    240
TRCSGSLAVR YGTMRDNVIS LKAVLANGEV VKTASRARKS AAGYDLTRLM IGSEGTLGVI    300
TEVTLRLQKI PKYSVVAMCN FPSIKDAADV AITTMLSGIQ VSRVELLDEV QVRAINIANG    360
KNLPETPTLM FEFIGTEAYS REQTQIVQRI VSEHNGSDFV FAEDTDAKKE LWKIRKEALW    420
ACFAMEPDFE AMISDVCVPL SCLAELISRS KQELDASELV CTVIAHAGDG NFHTVILFDP    480
NKEEHRREAE RLNHFMVHTA LSMEGTCTGE HGVGTGKMKY LEEELGAEAL KTMKRIKVAL    540
DPNNIMNPGK LIPSHVCF*                                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK11230PRK112302.0e-53136557428+
pfam02913FAD-oxidase_C2.0e-68310551247+
TIGR00387glcD5.0e-95140550420+
COG0277GlcD1.0e-122104554465+
PLN02805PLN02805047558518+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F7.00649e-4313955254476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E7.00649e-4313955254476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D7.00649e-4313955254476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C7.00649e-4313955254476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B7.00649e-4313955254476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata487468
Brassica rapaBra009208
Carica papayaevm.model.supercontig_222.7
Capsella rubellaCarubv10000524m
Citrus clementinaCiclev10011373m
Citrus sinensisorange1.1g011962morange1.1g015664morange1.1g015624morange1.1g008252m
Cucumis sativusCucsa.242270.1
Eucalyptus grandisEucgr.A02536.1
Glycine maxGlyma03g36390.2Glyma03g36390.1
Gossypium raimondiiGorai.006G146800.1
Malus domesticaMDP0000293317MDP0000201766
Manihot esculentacassava4.1_004573m
Mimulus guttatusmgv1a003632m
Physcomitrella patensPp1s18_85V6.1
Phaseolus vulgarisPhvul.001G199000.1
Picea abiesMA_9447266g0050
Populus trichocarpaPotri.016G064800.13Potri.016G064800.1Potri.016G064800.10Potri.016G064800.11Potri.016G064800.2
Potri.016G064800.3Potri.016G064800.4Potri.016G064800.5Potri.016G064800.6Potri.016G064800.7
Potri.016G064800.8Potri.016G064800.9Potri.016G064800.12
Prunus persicappa003803m
Ricinus communis29333.m001099
Thellungiella halophilaThhalv10013121m
Vitis viniferaGSVIVT01022507001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny