y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna18180.1-v1.0-hybrid
FamilyPL1
Protein PropertiesLength: 377 Molecular Weight: 41730 Isoelectric Point: 8.1942
ChromosomeChromosome/Scaffold: 6 Start: 4623993 End: 4626942
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11052840
  IVFDISGTINLSSYLNVSSHKTIDGRGQRIKFTGKGLRLKECEHVIICNLEFEGGRGPDVDGIQIKPNSKHIWIDRCSLRDYEDGLIDITRCSTDITISR
  CHFSEHDKTMLIGADPSHVDDRCIRVTIHHCFFDGTRQRHPRVRFAKVHLYNNYTRNWGIYAVCASVESQIYSQCNIYEA
Full Sequence
Protein Sequence     Length: 377     Download
MGNSHGHRKH RNGAKHPVTA TPPFKYQSSD HPEAHNPSSS KPIMAVSLPY SHVDSSLRAL    60
AAQAEGFGRL AIGGLHGPLY HVTTLADDGP GSLREACRKK EPLWIVFDIS GTINLSSYLN    120
VSSHKTIDGR GQRIKFTGKG LRLKECEHVI ICNLEFEGGR GPDVDGIQIK PNSKHIWIDR    180
CSLRDYEDGL IDITRCSTDI TISRCHFSEH DKTMLIGADP SHVDDRCIRV TIHHCFFDGT    240
RQRHPRVRFA KVHLYNNYTR NWGIYAVCAS VESQIYSQCN IYEAGQKKIA FKYLTEKAAD    300
KEAATTGFIK SEGDLFITGT KAGSSTEGGE DCTFHPSKHY QTWTVGPPVD DLKHVLQHCT    360
GWQSIPRPAD QASVAS*                                                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C6.0e-38100280201+
COG3866PelB7.0e-4973355302+
smart00656Amb_all3.0e-65112285188+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B2e-405134112328A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A2e-405134112328A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A5e-257228222246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A5e-25121282130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A1e-2410134846300A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)