y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna18817.1-v1.0-hybrid
FamilyGT4
Protein PropertiesLength: 435 Molecular Weight: 48858.1 Isoelectric Point: 5.8949
ChromosomeChromosome/Scaffold: 6 Start: 6454287 End: 6458188
Descriptionsulfoquinovosyldiacylglycerol 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42253742.2e-36
  GEPEKPLIVHVGRLGVEKSLDFLKSVMDRLPEARIAFIGDGPYRAELEELFSGMPAVFTGMLGGEELSQAYASGDVFLMPSESETLGLVVLEAMASGIPV
  VAARAGGIPDIIPDDQEGKTGFLYNYNDLDDCLSKLQPLLENKELRETIG
Full Sequence
Protein Sequence     Length: 435     Download
MTITEVGQEE EEEGPPPYVE SESNSRPRRI ALFVEPSPFA YVSGYKNRFQ NFIRYLREMG    60
DEVMVVTTHE GVPEEFYGAK CIGSRSFPCP WYQNVPLSLA LSPRIISEVA NFKPDIIHAS    120
SPGIMVFGAL IIAKLLSVPI VMSYHTHVPI YSKIHLQLVG ETHVDEFLHT AADLTLVPSA    180
AIAKDLQVAR VAAANTIRLW NKGVDSESFH PRFRSDEMRS RLSNGEPEKP LIVHVGRLGV    240
EKSLDFLKSV MDRLPEARIA FIGDGPYRAE LEELFSGMPA VFTGMLGGEE LSQAYASGDV    300
FLMPSESETL GLVVLEAMAS GIPVVAARAG GIPDIIPDDQ EGKTGFLYNY NDLDDCLSKL    360
QPLLENKELR ETIGKAARKE TEKFDWKAAT RVIRNEQYNA AIWFWRRRRA QFLRPLQWLM    420
KRIFPQTPPE IKYR*                                                     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like2.0e-4930394387+
cd03801GT1_YqgM_like6.0e-6329391375+
TIGR00032argG1.0e-6829385377+
TIGR00009L283.0e-11229391369+
PLN02871PLN02871025429408+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3c4v_B4e-16172402165406A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3c4v_A4e-16172402165406A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3c4q_B4e-16172402165406A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A4e-16172402165406A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c48_B4e-16172402185426A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00305.1Aquca_053_00022.3Aquca_053_00022.2Aquca_053_00022.1
Arabidopsis lyrata860579323188
Arabidopsis thalianaAT5G01220.1AT3G45100.2AT3G45100.1
Brachypodium distachyonBradi1g59860.1Bradi2g02800.1Bradi1g67200.1Bradi1g32610.1
Brassica rapaBra009633Bra005694Bra009589
Carica papayaevm.model.supercontig_163.3evm.model.supercontig_65.21
Capsella rubellaCarubv10000742mCarubv10019008m
Chlamydomonas reinhardtiiCre01.g038550.t1.3Cre16.g689150.t1.2Cre01.g006800.t1.3
Citrus clementinaCiclev10011473mCiclev10001141mCiclev10001076m
Citrus sinensisorange1.1g022615morange1.1g017114morange1.1g016648morange1.1g009759morange1.1g027511m
Cucumis sativusCucsa.176160.1Cucsa.143020.1
Eucalyptus grandisEucgr.A00516.1Eucgr.J00902.1
Fragaria vescamrna24819.1-v1.0-hybrid
Glycine maxGlyma03g14200.1Glyma01g27840.1Glyma18g42540.1Glyma07g17680.4Glyma07g17680.3
Glyma07g17680.2Glyma07g17680.1Glyma20g12140.9Glyma20g12140.8Glyma20g12140.7
Glyma20g12140.6Glyma20g12140.5Glyma20g12140.4Glyma20g12140.3Glyma20g12140.2
Glyma20g12140.10Glyma13g25060.1
Gossypium raimondiiGorai.012G112200.2Gorai.012G112200.1Gorai.002G261700.2Gorai.002G261700.6Gorai.002G261700.4
Gorai.002G261700.3Gorai.002G261700.1Gorai.003G143800.9Gorai.003G143800.8Gorai.003G143800.7
Gorai.003G143800.6Gorai.003G143800.5Gorai.003G143800.4Gorai.003G143800.3Gorai.003G143800.2
Gorai.003G143800.10Gorai.003G143800.1
Linum usitatissimumLus10004832Lus10002499Lus10024892Lus10022925
Malus domesticaMDP0000899469MDP0000143617MDP0000297386MDP0000273680MDP0000203472
MDP0000184748MDP0000198677
Manihot esculentacassava4.1_007989mcassava4.1_005643mcassava4.1_032287m
Medicago truncatulaMedtr4g015260.1Medtr7g067340.1
Mimulus guttatusmgv1a004620mmgv1a004551mmgv1a006150mmgv1a006148m
Oryza sativaLOC_Os01g04920.1LOC_Os07g01030.1LOC_Os03g15840.1LOC_Os07g16960.1
Panicum virgatumPavirv00011082mPavirv00023556mPavirv00064963mPavirv00000330mPavirv00022111m
Pavirv00063251mPavirv00030308mPavirv00006595mPavirv00056553mPavirv00006877m
Physcomitrella patensPp1s24_194V6.1Pp1s106_103V6.1
Phaseolus vulgarisPhvul.010G005100.1Phvul.008G106900.1Phvul.005G132400.1Phvul.002G226400.1
Picea abiesMA_158718g0080MA_60607g0010MA_159042g1330MA_159118g0680MA_159090g0090
MA_159042g1140
Populus trichocarpaPotri.016G112600.4Potri.016G112600.3Potri.016G112600.2Potri.016G112600.1Potri.006G097600.3
Potri.006G097600.2Potri.006G097600.1Potri.016G130000.1
Prunus persicappa004263mppa005676mppa018035m
Ricinus communis35899.m00002429969.m00027234675.m00002848584.m00001330418.m000015
32791.m00002229638.m00053127698.m000067
Setaria italicaSi020690mSi001496mSi035897mSi035683m
Selaginella moellendorffii170091406541
Sorghum bicolorSb02g000240.1Sb03g006480.1Sb01g040150.1Sb02g008800.1
Thellungiella halophilaThhalv10013276mThhalv10002532m
Vitis viniferaGSVIVT01033998001GSVIVT01024777001
Volvox carteriVocar20009459mVocar20001320m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)