y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna18893.1-v1.0-hybrid
FamilyGH16
Protein PropertiesLength: 215 Molecular Weight: 24500.4 Isoelectric Point: 5.2963
ChromosomeChromosome/Scaffold: 7 Start: 4042898 End: 4043545
Descriptionendoxyloglucan transferase A3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16472029.1e-26
  RGGARWRTPTRFLYGTFSALIQCPSGNTSGLNFNLYLSSLEGDKSQDEIDFEFLGKDMTIVQTNYYTEGAGNKEAIHDLGFNCSEGFHEYVIKWSKDVIE
  WFINGKMVRRVERKEGEGFPNKPMYLYSSVWDASYIDKGRWTGKYVGCDVPYVCVY
Full Sequence
Protein Sequence     Length: 215     Download
MADPALHPET PSHHKTQPLK QIAIDYTPDA CTHFTDSNTI TVTFDHRGGA RWRTPTRFLY    60
GTFSALIQCP SGNTSGLNFN LYLSSLEGDK SQDEIDFEFL GKDMTIVQTN YYTEGAGNKE    120
AIHDLGFNCS EGFHEYVIKW SKDVIEWFIN GKMVRRVERK EGEGFPNKPM YLYSSVWDAS    180
YIDKGRWTGK YVGCDVPYVC VYKDIHVPLE TAVED                               240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase1.0e-229217792+
PLN03161PLN031618.0e-2445179141+
cd02175GH16_lichenase4.0e-3449191145+
cd02176GH16_XET1.0e-3636180151+
pfam00722Glyco_hydro_164.0e-4135191158+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vh9_B3e-233520758234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A3e-233520758234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2uwb_B3e-233520735211A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwb_A3e-233520735211A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwc_B2e-213520734215A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
Hydropathy
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Glycine maxGlyma07g08550.2
Gossypium raimondiiGorai.007G095000.2Gorai.007G095000.1
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s24_272V6.1Pp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.2Pp1s353_23V6.3
Pp1s353_23V6.4Pp1s353_23V6.5
Phaseolus vulgarisPhvul.010G092400.1
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny