y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna19062.1-v1.0-hybrid
FamilyGT90
Protein PropertiesLength: 525 Molecular Weight: 61308.9 Isoelectric Point: 8.2639
ChromosomeChromosome/Scaffold: 7 Start: 3540640 End: 3542947
Descriptiondownstream target of AGL15 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT901974440
  RLPDLEIMFDCDDRPVVRSRDFQGPNAGPPPVFRYCADEGSLDIVFPDWSFWGWAETNIKPWKNLLPKIKEGNKRTKWKDRVPYAYWKGNPNVAPTRKDL
  LKCNVSDQNDWNTLLYIQNWEKESKEGYKQSSLEDQCKHRYKIYIEGWAWSVSEKYIMACDSMTLYVNPHFYDFYMRGMLPLEHYWPIRDNSKCTSLKFA
  VEWGNNHTEKAEAIGKAASNFIQEDLKMDYVYDYMFHVLNEYAKLLKF
Full Sequence
Protein Sequence     Length: 525     Download
MKRNNAKHLY DILDGSGLHR HIAGSSWQPL KKRSATFTTI AFLFLLFFFV AALVYGAGWS    60
VDIDSFIFSG ASSNKSILTP TTTIPKTIEF PLQCTTDTNV TQTCPRTYPS KHNPTNPNLP    120
SNVTCPAYFR WIHEDLRPWR ETGITRDMVE RARRTAHFRL VIVDGKAYLE KYRQSIQTRD    180
MFTLWGILQL LRVYPGRLPD LEIMFDCDDR PVVRSRDFQG PNAGPPPVFR YCADEGSLDI    240
VFPDWSFWGW AETNIKPWKN LLPKIKEGNK RTKWKDRVPY AYWKGNPNVA PTRKDLLKCN    300
VSDQNDWNTL LYIQNWEKES KEGYKQSSLE DQCKHRYKIY IEGWAWSVSE KYIMACDSMT    360
LYVNPHFYDF YMRGMLPLEH YWPIRDNSKC TSLKFAVEWG NNHTEKAEAI GKAASNFIQE    420
DLKMDYVYDY MFHVLNEYAK LLKFKPTIPP NAVELCSETM ACPTTGTWNK FMEESMVMSP    480
SDEIPCSLPP PYDPQALRSF LERKANSTRQ VEDWENEYWQ NSRKP                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05686Glyco_transf_903.0e-52400515116+
pfam05686Glyco_transf_903.0e-105121294174+
smart00672CAP102.0e-123197445256+
Transmembrane Domains
StartEnd
3759
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_038_00046.1Aquca_004_00351.1Aquca_045_00089.1
Arabidopsis lyrata910396485256483721887933486604
483723475010
Arabidopsis thalianaAT5G23850.1AT3G48980.1AT3G61290.1AT3G61280.1AT2G45830.2
AT2G45830.1AT2G45840.1AT1G07220.1AT3G61270.1AT1G63420.1
AT3G61280.2
Brachypodium distachyonBradi3g50030.1Bradi5g16810.1Bradi5g16797.1Bradi2g07460.1Bradi1g61560.1
Bradi2g35840.1
Brassica rapaBra018021Bra009709Bra007591Bra007592Bra014445
Bra007593Bra003444Bra007590Bra031558Bra015563
Bra027639Bra004942Bra039310
Carica papayaevm.model.supercontig_18.237evm.model.supercontig_112.24evm.model.supercontig_18.236evm.model.supercontig_107.57
Capsella rubellaCarubv10000648mCarubv10016976mCarubv10019114mCarubv10016988mCarubv10008891m
Carubv10020086mCarubv10018865mCarubv10025566mCarubv10025651m
Chlamydomonas reinhardtiiCre02.g117650.t1.3Cre09.g413500.t1.3Cre12.g531750.t1.2Cre14.g621800.t1.3
Citrus clementinaCiclev10007061mCiclev10023948mCiclev10019760mCiclev10004696mCiclev10019647m
Ciclev10028388mCiclev10020660mCiclev10020252mCiclev10021346mCiclev10020817m
Ciclev10006549m
Citrus sinensisorange1.1g043671morange1.1g044043morange1.1g017178morange1.1g016930morange1.1g011607m
orange1.1g009387morange1.1g011592morange1.1g046815morange1.1g017360morange1.1g022616m
orange1.1g022102morange1.1g022101morange1.1g039857m
Cucumis sativusCucsa.107800.1Cucsa.107750.1Cucsa.135430.1Cucsa.302970.1Cucsa.147060.1
Cucsa.107720.1
Eucalyptus grandisEucgr.A02783.1Eucgr.D01868.1Eucgr.D01866.1Eucgr.E00165.1Eucgr.E00167.1
Eucgr.E00163.1Eucgr.J01883.1Eucgr.D02274.1Eucgr.I01244.1Eucgr.E00171.1
Eucgr.E00168.1Eucgr.E00166.1Eucgr.D01868.3Eucgr.D01868.2.50.190Eucgr.D01868.2.50.190
Eucgr.D01868.2.190.261Eucgr.D01868.2.190.261
Fragaria vescamrna32446.1-v1.0-hybrid.718.966mrna32446.1-v1.0-hybrid.718.966mrna32446.1-v1.0-hybrid.207.452mrna32446.1-v1.0-hybrid.207.452mrna13268.1-v1.0-hybrid.664.916
mrna13268.1-v1.0-hybrid.664.916mrna07900.1-v1.0-hybridmrna13268.1-v1.0-hybrid.179.419mrna13268.1-v1.0-hybrid.179.419
Glycine maxGlyma16g31231.2Glyma16g31231.1Glyma16g31231.4Glyma16g31231.3Glyma03g01480.2
Glyma09g25490.2Glyma01g42740.2Glyma01g42740.1Glyma07g07910.2Glyma07g08000.2
Glyma03g01490.3Glyma03g01490.2Glyma03g01490.1Glyma18g07010.1Glyma11g27050.2
Glyma11g27050.1Glyma03g01580.2Glyma18g46490.1Glyma09g39700.1Glyma0920s00200.1
Glyma16g30430.2Glyma16g30561.1Glyma16g30313.1Glyma16g31241.1
Gossypium raimondiiGorai.004G157700.1Gorai.007G098000.1Gorai.008G277100.1Gorai.007G097900.1Gorai.008G246000.1
Gorai.007G097800.1Gorai.001G116200.1Gorai.008G118500.1.121.260Gorai.008G118500.1.121.260Gorai.008G118500.1.262.331
Gorai.008G118500.1.262.331
Linum usitatissimumLus10039228Lus10040665Lus10018239Lus10039226Lus10024519
Lus10027472Lus10027473Lus10037863.306.434Lus10037863.306.434Lus10008017
Lus10037864.295.404Lus10037864.295.404Lus10037864.182.299Lus10037864.182.299Lus10037863.212.306
Lus10037863.212.306
Malus domesticaMDP0000322698MDP0000322697MDP0000322107MDP0000167387MDP0000158437
MDP0000289383MDP0000239614MDP0000147543MDP0000304021MDP0000246269
MDP0000261453MDP0000151647
Manihot esculentacassava4.1_032880mcassava4.1_028860mcassava4.1_005486mcassava4.1_025567mcassava4.1_027328m
cassava4.1_006037mcassava4.1_007061m.169.306cassava4.1_007061m.169.306cassava4.1_007061m.306.383cassava4.1_007061m.306.383
Medicago truncatulaMedtr6g031170.1Medtr7g076890.1Medtr7g076860.1Medtr5g010500.1Medtr6g031200.1
Medtr6g031190.1
Mimulus guttatusmgv1a020993mmgv1a004518mmgv1a010063m
Oryza sativaLOC_Os02g42920.1LOC_Os04g45160.1LOC_Os04g45140.1LOC_Os05g05690.1LOC_Os08g01150.1
LOC_Os04g45160.2LOC_Os06g05940.1
Panicum virgatumPavirv00027487mPavirv00066339mPavirv00043004mPavirv00000938mPavirv00017588m
Pavirv00066593mPavirv00063931mPavirv00046116mPavirv00058150mPavirv00052814m
Pavirv00002686mPavirv00035277mPavirv00024822mPavirv00027719mPavirv00069435m
Pavirv00064656mPavirv00033981mPavirv00004308mPavirv00021245m.180.302Pavirv00021245m.180.302
Pavirv00063538mPavirv00021245m.77.169Pavirv00021245m.77.169
Phaseolus vulgarisPhvul.004G116000.1Phvul.010G096100.1Phvul.010G096500.1Phvul.006G068300.1
Picea abiesMA_53054g0010MA_32961g0010MA_116478g0010MA_55748g0010MA_10425862g0010
MA_689724g0010MA_129161g0010MA_10435424g0020MA_23554g0010MA_912717g0010
MA_9597898g0010MA_4631294g0010
Populus trichocarpaPotri.015G144400.2Potri.015G144400.1Potri.003G125000.3Potri.003G125000.2Potri.003G125000.1
Potri.014G081600.1Potri.001G252000.1Potri.002G157800.2Potri.002G157800.1Potri.002G157900.1
Prunus persicappa023179mppa005169mppa004159mppa014578mppa024728m
ppa019065mppa008339mppa026562m
Ricinus communis30147.m01373930147.m01374030174.m00900430174.m00900529681.m001352
30190.m011190
Setaria italicaSi035011mSi016818mSi009846mSi009843mSi024592m
Si012640mSi006188mSi025803mSi013493mSi039647m
Si008749m
Selaginella moellendorffii10148312256141909153405442089
6285062763910456480381791
6314353728
Sorghum bicolorSb06g023680.1Sb04g033620.1Sb06g023670.1Sb09g003810.1Sb10g003730.1
Sb07g000280.1
Thellungiella halophilaThhalv10003948mThhalv10010269mThhalv10005889mThhalv10023375mThhalv10006441m
Thhalv10001309m.50.298Thhalv10001309m.50.298Thhalv10001309m.501.754Thhalv10001309m.501.754Thhalv10007804m
Vitis viniferaGSVIVT01028972001GSVIVT01026877001.101.348GSVIVT01026877001.101.348GSVIVT01019779001GSVIVT01026877001.483.731
GSVIVT01026877001.483.731GSVIVT01026872001GSVIVT01024736001GSVIVT01026876001GSVIVT01026878001
GSVIVT01026871001.50.297GSVIVT01026871001.50.297GSVIVT01026871001.50.297GSVIVT01026873001GSVIVT01028968001
GSVIVT01026871001.476.608GSVIVT01026871001.476.608GSVIVT01026871001.476.608GSVIVT01026871001.628.756GSVIVT01026871001.628.756
GSVIVT01026871001.628.756GSVIVT01026874001
Volvox carteriVocar20006148mVocar20001995m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)