y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna19575.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 664 Molecular Weight: 73582.8 Isoelectric Point: 8.7331
ChromosomeChromosome/Scaffold: 3 Start: 269235 End: 275378
Descriptionglucose 6-phosphate/phosphate translocator 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13626090
  SQFEGAFLNDGKSLNNWDVFSHKPGNILDGTNGDIAVDQYHLYQEDLDLMDYIGVNSYRFSISWARILPKGRFGKVNRAGIDHYNKLIDALLLRGIQPFV
  TLTHYDIPQELEDRYGAWLSPLLQEDFRYYADICFKFFGDRVKYWSTFNEPNVLAIRGYRSGIYPPSHCSLPFGNCISGDSEREPFIAAHNIILSHAAAV
  NVYRTKYQKKQEGSIGIVMNAVWYEPISSSLEDKLAAERAQSFYINCT
Full Sequence
Protein Sequence     Length: 664     Download
MISSVRLRNP TFTSAQFLST QKCSLGKAEC CSLPNIQYPK QSMLCFHKPL HISSAESFAL    60
VAKTQKRDST RCEAYEADRS RPIEINIDLP DQQARKETAQ TLRISVYFAT WWALNVVFNI    120
YNKKVLNVFP FPWLTSTLSL ATGSLMMLIS WAVGIAEAPK TDMDFWKILF PVAVAHSIGH    180
VAATVSMANV AVSFTHIIKS GEPAFSVLVS RLFLGETFPT SVYLSLLPII GGCALAAVTE    240
INFNMIGFMG AMISNLAFVF RNIFSKKGMK GKSVSGMNYY ACLSMLSLLI LIPFAIAVEG    300
PQAWAAGWKT ALAQIGPNFV CIGNTMKRIS VIVSSIIIFR TPIQPVNCLG AAIAIFGTFL    360
YSQFEGAFLN DGKSLNNWDV FSHKPGNILD GTNGDIAVDQ YHLYQEDLDL MDYIGVNSYR    420
FSISWARILP KGRFGKVNRA GIDHYNKLID ALLLRGIQPF VTLTHYDIPQ ELEDRYGAWL    480
SPLLQEDFRY YADICFKFFG DRVKYWSTFN EPNVLAIRGY RSGIYPPSHC SLPFGNCISG    540
DSEREPFIAA HNIILSHAAA VNVYRTKYQK KQEGSIGIVM NAVWYEPISS SLEDKLAAER    600
AQSFYINCTG DGAPPPQKTP ATSPTTSLLR RGGEWTDIRT LSRVRTSTSY PSAQGPSNEG    660
SLF*                                                                 720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028494.0e-76349606258+
COG2723BglB3.0e-82350607260+
TIGR03356BGL2.0e-83348604257+
TIGR00817tpt2.0e-86102363293+
pfam00232Glyco_hydro_18.0e-96350604256+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016020membrane
GO:0055085transmembrane transport
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A035561122279B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3gnp_A035561122279B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3gno_A035561122279A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3scw_B035560625273A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose
PDB3scw_A035560625273A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose
Transmembrane Domains
StartEnd
104121
131153
222241
245264
276298
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)