y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna19576.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 209 Molecular Weight: 24098.1 Isoelectric Point: 4.6031
ChromosomeChromosome/Scaffold: 3 Start: 277741 End: 278645
Descriptionbeta-glucosidase 45
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH121990
  HELLGDDLPEFSMFDMEMLKNGLDFIGINHYTSFYSKDCMISPCEPGPGVSRTEGYALRTAQKDGIYIGEPTAVDWLYVHPQGMEKMVTYIKERYNNTPM
  FITENGYAEEANSNTTNEEQFNDVKRVEYMRSYLQALADTMRTKGADVRGYFVWSLLDNFEWTSGYTVQFGLHHVDNVTLKRTPRLSADWYRQFIVNN
Full Sequence
Protein Sequence     Length: 209     Download
MHELLGDDLP EFSMFDMEML KNGLDFIGIN HYTSFYSKDC MISPCEPGPG VSRTEGYALR    60
TAQKDGIYIG EPTAVDWLYV HPQGMEKMVT YIKERYNNTP MFITENGYAE EANSNTTNEE    120
QFNDVKRVEY MRSYLQALAD TMRTKGADVR GYFVWSLLDN FEWTSGYTVQ FGLHHVDNVT    180
LKRTPRLSAD WYRQFIVNNT LQILSAQE*                                      240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028497.0e-301200203+
COG2723BglB1.0e-317200197+
PLN02814PLN028141.0e-351205213+
TIGR03356BGL2.0e-463192194+
pfam00232Glyco_hydro_18.0e-501199202+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B1.96182e-441197310504A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ptq_A1.96182e-441197310504A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ptm_B1.96182e-441197310504A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ptm_A1.96182e-441197310504A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ptk_B1.96182e-441197310504A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
Orthologous Group
SpeciesID
Panicum virgatumPavirv00028433mPavirv00028432mPavirv00056463m
Sorghum bicolorSb06g022470.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny