y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna19924.1-v1.0-hybrid
FamilyGT92
Protein PropertiesLength: 513 Molecular Weight: 58347 Isoelectric Point: 9.4572
ChromosomeChromosome/Scaffold: 3 Start: 7037400 End: 7040004
DescriptionDomain of unknown function (DUF23)
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT922514630
  DYFYCGSSLYGNLSPQRVREWIAYHVRLFGPRSHFVIHDAGGIHEEVLEVLKPWMELGYVTLHDIRDQERFDGYYHNQFMVVNDCLHRYKFMAKWMFFFD
  VDEYIYMPPKSTIKTVLDSLAEYSQFTIEQMPMSNKLCLLEDYHKTNRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVYGTGVHMSQNIAGKTTHKTENRI
  KYFHYHGTIADRR
Full Sequence
Protein Sequence     Length: 513     Download
MAKEKQQKEE KKLYVGIVWH YTAELKLLLT ALLILCTLAT LLQFLPSRFT VSSSDLRFCI    60
SRVLTPTQPA QQHNTTNTTI VSISAAAATS PPPLLSPPPP PSESVQPNGM IKRVFGTHGA    120
AAYSYINMGT YRGGMNTFAI VGLASKPLHL YSNPTYQCRW IPTVNSSAVV SAVGYKILPD    180
WGYGRVYTVV VVNCTFSQDV NSDNSGGKLV LLASTSGGGD RNLNVTDEIE ALTENPGSLN    240
PSIFTSKPKY DYFYCGSSLY GNLSPQRVRE WIAYHVRLFG PRSHFVIHDA GGIHEEVLEV    300
LKPWMELGYV TLHDIRDQER FDGYYHNQFM VVNDCLHRYK FMAKWMFFFD VDEYIYMPPK    360
STIKTVLDSL AEYSQFTIEQ MPMSNKLCLL EDYHKTNRKW GFEKLVYKDV KRGIRRDRKY    420
AVQPRNVYGT GVHMSQNIAG KTTHKTENRI KYFHYHGTIA DRREPCKKLI NDTQIYLDKV    480
PYVIDTTMRD VAGAVKRFEL RMIGSRLQQT RQ*                                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13704Glyco_tranf_2_40.000527035990+
pfam01697Glyco_transf_925.0e-28250443208+
Transmembrane Domains
StartEnd
1335
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00278.2Aquca_030_00278.1Aquca_007_00975.1
Arabidopsis lyrata492851494517902431
Arabidopsis thalianaAT5G44670.1AT4G20170.1AT2G33570.1AT5G48190.1AT3G60990.1
AT3G07380.1
Brachypodium distachyonBradi1g42556.1Bradi1g35710.2Bradi1g35710.1Bradi3g53170.1
Brassica rapaBra020933Bra033759Bra022944Bra005484
Carica papayaevm.model.supercontig_1291.2evm.model.supercontig_36.102
Capsella rubellaCarubv10004512mCarubv10026267mCarubv10023079m
Citrus clementinaCiclev10014882m
Citrus sinensisorange1.1g009350m
Cucumis sativusCucsa.049020.1
Eucalyptus grandisEucgr.E04328.1Eucgr.F03619.1
Fragaria vescamrna29146.1-v1.0-hybrid
Glycine maxGlyma09g05300.2Glyma15g16630.1Glyma16g14690.1Glyma08g36030.2
Gossypium raimondiiGorai.008G052100.1Gorai.007G359700.1Gorai.006G138000.1
Linum usitatissimumLus10008076Lus10038387Lus10024731Lus10036247
Malus domesticaMDP0000126481MDP0000126479MDP0000661922MDP0000203716
Manihot esculentacassava4.1_005572mcassava4.1_005594mcassava4.1_006235m
Medicago truncatulaMedtr8g070700.1
Mimulus guttatusmgv1a004537mmgv1a005071m
Oryza sativaLOC_Os06g22330.1LOC_Os02g48190.1LOC_Os06g41910.1
Panicum virgatumPavirv00018157mPavirv00039959mPavirv00055571mPavirv00069450mPavirv00047984m
Pavirv00032304m
Physcomitrella patensPp1s35_57V6.1Pp1s98_254V6.1Pp1s198_141V6.1Pp1s227_17V6.1Pp1s35_63V6.1
Pp1s32_144V6.1Pp1s112_159V6.1Pp1s237_6V6.1Pp1s225_53V6.1Pp1s556_1V6.1
Pp1s25_268V6.1Pp1s401_34V6.1Pp1s88_162V6.1
Phaseolus vulgarisPhvul.009G244900.1Phvul.003G275200.1
Picea abiesMA_2788g0010MA_102296g0010MA_630451g0010MA_127644g0010MA_169299g0010
MA_43513g0010MA_401686g0010MA_10433350g0010MA_99230g0010MA_960165g0010.252.357
MA_960165g0010.252.357MA_960165g0010.360.466MA_960165g0010.360.466MA_898638g0010
Populus trichocarpaPotri.001G074600.1Potri.003G156600.1Potri.005G258900.1
Prunus persicappa004238mppa025548m
Ricinus communis28563.m00009330170.m014246
Setaria italicaSi017001mSi006264m
Selaginella moellendorffii77156406883
Sorghum bicolorSb10g013010.1Sb10g024570.1Sb04g030080.1
Thellungiella halophilaThhalv10024965mThhalv10000855mThhalv10016550m
Vitis viniferaGSVIVT01010061001GSVIVT01013454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)