y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna19962.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 628 Molecular Weight: 70304.3 Isoelectric Point: 7.9264
ChromosomeChromosome/Scaffold: 3 Start: 7217259 End: 7221048
DescriptionUDP-glucosyl transferase 78D2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT14275998.4e-31
  VQSSDDDGCLQWLDKQEPASVAYISFGTAGALPPMEVAALAEALEERRFPFVWSFRGNQEEFPQGFIERTERLSLGKVVPWVNQEKILNHTSVGVFVTHC
  GWSSILESITGGVPMIGKPSFADQNMCMRSLEVVWRIGVKIEGGVFTKTGAVKALEQALLLEQGKEMRQRVGI
Full Sequence
Protein Sequence     Length: 628     Download
MESSCRCTCK APSEAVTRSN ISAWSSDRTR GEKQMERTSL AVTQSNISAE GAEQHSAIGA    60
KFRRENEISK VSDSGIKRYV TTTSMERAFS APRIIKSRLR SNIEEEFLDD CMLVHIERQF    120
ADSIDKESII DEFATKTPLN QFAHVEPAMN PQLGSRRRLS QRGRRWLGGE RRRRREEIDG    180
KKVRDNADEK QLVSAFCSSI VPSFLVGLCK KFTFFNTPRS NSSLFSGSGN MSYDNIKPYN    240
VWDGMRDGYT PPSSGYPPLQ QVESFRDTAP GNFEKAIKEV EAATGRKFDL LISDAILCWF    300
ASDLAEKMHV TWVPFWISTQ RSLLAFVEID IINAKIGAQG QEDTTLEFLP GFSNEFRASD    360
LPREIPLGDI KPPLARMFHK MGQKLPRATV VAINSFETMD LKVTEELKKR LRMLVLVGPQ    420
HLVVQPVQSS DDDGCLQWLD KQEPASVAYI SFGTAGALPP MEVAALAEAL EERRFPFVWS    480
FRGNQEEFPQ GFIERTERLS LGKVVPWVNQ EKILNHTSVG VFVTHCGWSS ILESITGGVP    540
MIGKPSFADQ NMCMRSLEVV WRIGVKIEGG VFTKTGAVKA LEQALLLEQG KEMRQRVGIL    600
KHLALEAVEH NGRSAQDLKA LVDIIKS*                                       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025553.0e-31282626366+
PLN02173PLN021735.0e-32291627357+
PLN02410PLN024108.0e-33388627251+
PLN02992PLN029928.0e-33373617276+
PLN02448PLN024484.0e-33289627362+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hbj_A022162755454A Chain A, The Structure Of Soybean Peroxidase
PDB3hbf_A022162755454A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c9z_A021262540450A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1z_A021262540450A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1x_A021262540450A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybridmrna11467.1-v1.0-hybrid
mrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)