y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20066.1-v1.0-hybrid
FamilyGT65
Protein PropertiesLength: 662 Molecular Weight: 75021.9 Isoelectric Point: 8.7797
ChromosomeChromosome/Scaffold: 3 Start: 7886097 End: 7896203
DescriptionO-fucosyltransferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT651454510
  GLNNQKIAFARACLTARLMNRILLMPSLSASLFYKEFELLKPISFDKVFKFDKFNSLCDGYVQLGQYSDLKNQTGAFELQKGSGRRWTPERDLDQLKQHS
  KGPYDEHETIRIVGKNPFLWHDHWPVKDYAKVFECLVLVDEIMKEADKVVSRIREIGAEQVRRKSESAENSLLVEPVPYVAVHMRIELDWMIHCKNLERR
  LNITEICSSKEEIMERVGNIVGLKTPVVVYLAVADSLLQDPSILNGWKEGLVPFEKKKLGFDAQYKKFPYLIQSAIDYEVCLRADVFVGNSFSTFSSLIA
  LDRTQKL
Full Sequence
Protein Sequence     Length: 662     Download
MIGAAGQRGV ELRLKHDWIF ARTMRHGLLK VEIGKLDLMG ERLSKMEHID HPKADDGAMM    60
DLSPHCKHFR SLGCNLNSIA CKCVVLVIIA LVVRAVLLPT YSSFNGTEQN KLVLVSNLSF    120
STLSGSTNFG IRKDKFLEVP QIVWGLNNQK IAFARACLTA RLMNRILLMP SLSASLFYKE    180
FELLKPISFD KVFKFDKFNS LCDGYVQLGQ YSDLKNQTGA FELQKGSGRR WTPERDLDQL    240
KQHSKGPYDE HETIRIVGKN PFLWHDHWPV KDYAKVFECL VLVDEIMKEA DKVVSRIREI    300
GAEQVRRKSE SAENSLLVEP VPYVAVHMRI ELDWMIHCKN LERRLNITEI CSSKEEIMER    360
VGNIVGLKTP VVVYLAVADS LLQDPSILNG WKEGLVPFEK KKLGFDAQYK KFPYLIQSAI    420
DYEVCLRADV FVGNSFSTFS SLIALDRTQK LIKMGVNSSC GVDVRYGTDD QMRWYNKGKG    480
VLNPHFSTSN TIKDDRFNDY KMAANLTTSV PGGSASVAVD MVPLVSTLLE GFAIWLECLA    540
CLLALMFGFP FIVIVAQGPS LPSPSIRLSN SFAGRFRLDD WTAAIPSSMF SLFNLKQKSG    600
IYSRSVIGND FADLESHGGG WDFLRENRCF SDLKMVKKWD EWKRRFGYIE AGQFYRYFKK    660
E*                                                                   720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.00213617035+
cd11302O-FucT-10.0007284447184+
cd11299O-FucT_plant2.0e-14145448332+
cd11296O-FucT_like4.0e-24266448187+
pfam10250O-FucT2.0e-39145448337+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.00003322447212344A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB3zy5_A0.00003322447212344A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB3zy4_A0.00003322447212344A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB3zy3_B0.00003322447212344A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB3zy3_A0.00003322447212344A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Transmembrane Domains
StartEnd
7698
533555
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny