y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20137.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 201 Molecular Weight: 21714 Isoelectric Point: 6.5131
ChromosomeChromosome/Scaffold: 3 Start: 8339234 End: 8340062
DescriptionGlycosyl hydrolase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17271671.3004e-42
  PSQYLLPVVQNIQNTVTAAYLQGQIKVSTAIDTTLLGPSFPSSNGAFSNAANSFITLIITFLGNNGALLRVNIHPYAYIGDPANIKLEYALFTSPGVVVQ
  DGNGYPNIFNAILDTHYSVLEKAGAPNTAIVVSKSGWPSEA
Full Sequence
Protein Sequence     Length: 201     Download
MCNPTRLMSS SNTMPLEMKY TLMLQKPSQY LLPVVQNIQN TVTAAYLQGQ IKVSTAIDTT    60
LLGPSFPSSN GAFSNAANSF ITLIITFLGN NGALLRVNIH PYAYIGDPAN IKLEYALFTS    120
PGVVVQDGNG YPNIFNAILD THYSVLEKAG APNTAIVVSK SGWPSEALYA QRLMEPDIYS    180
IANSWTPELL KGLPLIQILS *                                              240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_172.0e-3731166137+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A6e-3928165102241A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D1e-3828170106250A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C1e-3828170106250A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B1e-3828170106250A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A1e-3828170106250A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Hydropathy
Orthologous Group
SpeciesID
Linum usitatissimumLus10007208Lus10007212
Vitis viniferaGSVIVT01031544001.129.203GSVIVT01031544001.129.203
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny