y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20162.1-v1.0-hybrid
FamilyAA7
Protein PropertiesLength: 486 Molecular Weight: 54742.7 Isoelectric Point: 7.876
ChromosomeChromosome/Scaffold: 3 Start: 8463098 End: 8464768
DescriptionFAD-binding Berberine family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7702130
  NLRHYTPTTPKPLAIVTAKHESHVQATVMCAKQHGLHMRIRSGGHDYEGLSFISYISNASYIVLDMFNLREIDINIADESAWVGSGAILGELYYSIAQKS
  IVHAFPGGVCPSVGLGGLFSGGGYGSMMRKFGLTVDNIEDATLI
Full Sequence
Protein Sequence     Length: 486     Download
MKIPSSALLV FTLSVLSLSI SISWATSNPI LDDFFQCLPK YSNSSYPVSE AIITRENTIF    60
QSALLSYIRN LRHYTPTTPK PLAIVTAKHE SHVQATVMCA KQHGLHMRIR SGGHDYEGLS    120
FISYISNASY IVLDMFNLRE IDINIADESA WVGSGAILGE LYYSIAQKSI VHAFPGGVCP    180
SVGLGGLFSG GGYGSMMRKF GLTVDNIEDA TLIKLVRVPP IVTVFTVTKT LEQGAADVLH    240
RWQYVAPNLP KELFIRATSK VQNSTTQIGK KTVEVAFRGL YLGRRENLLS LVSDSFPELG    300
LEQKDCLEMS WIESTIYFAE YASGTPIKAL VKRPTQPPPF FFKGKSDYVK QPISKEILNL    360
IFDKMMNQYE TTHMQWNPYG GRMNEISESE TPFPHRAGNL FMIQYWTYWM DKGIESTDKY    420
LNLSINFYES MNPYVSKSPR EVLHNYRDLD IGSNVLDQNS TEHARVYGRS YFKGNFERLV    480
CEKCA*                                                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam08031BBE0.00544548339+
COG0277GlcD4.0e-661161102+
pfam01565FAD_binding_42.0e-1781213134+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3tsj_B0324839478B Chain B, Crystal Structure
PDB3tsj_A0324839478B Chain B, Crystal Structure
PDB3tsh_A0324839478A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity
PDB4dns_B03348312478A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB4dns_A03348312478A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
25
Hydropathy
Orthologous Group
SpeciesID
Brassica rapaBra023123.69.187Bra023123.69.187
Citrus clementinaCiclev10024072mCiclev10013575mCiclev10015575m
Citrus sinensisorange1.1g027960morange1.1g041546morange1.1g048047m
Eucalyptus grandisEucgr.F04104.1
Glycine maxGlyma15g16451.1
Malus domesticaMDP0000281703
Manihot esculentacassava4.1_028283m
Medicago truncatulaAC233560_1010.1.101.204AC233560_1010.1.101.204
Picea abiesMA_10427412g0010.242.461MA_228933g0010MA_10430302g0010MA_10427412g0010.242.461MA_613919g0010.76.206
MA_10427412g0010.57.194MA_10427412g0010.57.194MA_613919g0010.76.206
Populus trichocarpaPotri.001G462500.1
Prunus persicappa019537mppa017770mppa021171m
Vitis viniferaGSVIVT01021739001GSVIVT01021745001GSVIVT01037107001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny