y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20552.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 234 Molecular Weight: 25713.1 Isoelectric Point: 7.7198
ChromosomeChromosome/Scaffold: 3 Start: 29755931 End: 29757557
Descriptionbeta glucosidase 28
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1422139.80909e-45
  RSNFPAGFVFETASAAYQFEGAANQDKVVQDHVYGTPLLTSIQKMKDHSSGDVATDQCHRYKEDVKMLKDMGWDAYILNLMGKLSGGANQEGITYYKNLL
  NELQANALRHTLPLGYATSFREEFGGFLSPQIVNHFQDFAELCYKEFGDKVKHWTTLNEPLTYSVSGYATGA
Full Sequence
Protein Sequence     Length: 234     Download
MALRLGVLFG LLLVLSSTGI NGHSSRKASP QKKSRNYTSF SRSNFPAGFV FETASAAYQF    60
EGAANQDKVV QDHVYGTPLL TSIQKMKDHS SGDVATDQCH RYKEDVKMLK DMGWDAYILN    120
LMGKLSGGAN QEGITYYKNL LNELQANALR HTLPLGYATS FREEFGGFLS PQIVNHFQDF    180
AELCYKEFGD KVKHWTTLNE PLTYSVSGYA TGADVLLGKT LNAPVAIQGE SHI*          240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028494.0e-3240212181+
COG2723BglB1.0e-3542212190+
PLN02998PLN029985.0e-3740212184+
TIGR03356BGL4.0e-3846214190+
pfam00232Glyco_hydro_16.0e-4341214189+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A03621210195A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB4atl_B03421211198A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB4atl_A03421211198A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB4atd_B03421211198A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase
PDB4atd_A03421211198A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase
Signal Peptide
Cleavage Site
22
Hydropathy