y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20619.1-v1.0-hybrid
FamilyGH127
Protein PropertiesLength: 896 Molecular Weight: 99842 Isoelectric Point: 5.7219
ChromosomeChromosome/Scaffold: 3 Start: 30037935 End: 30043141
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1271846651.7e-29
  HYLSASAMMWASTHNDTLKEKMSGIVSSLALCQNEIGSGYLSAFPTLEFDKLENITYVWAPYYTIHKILAGLLDQYTLAGSDQAFSMVKWMVEYFYKRIQ
  NVISKYSIARHYMSLNEEAGGMNDILYKLYTITGDTKHLLLAHLFDKPCFLGLLAVKADDIAGYHTNTHVPVVIGAQKRYEVTGEPLYKGDVPSLLDMAL
  HLHSSSLHYRLEMGIFFMDIVNSSHTYATGGTSVSEFWSAPKRLATTLQTENEESCVTYNMLKVSRTLFRWTKEPAYADFYERALTNGVLGIQRGTEPGV
  MIYMLPLGSGRSKAISYHGWGSPFDHFWCCYGTGIESFSKLGDSIYFEEEGETPSLYIIQYISSSLDWKSGNVVLNQTVDNINPWDPYLRITLTFSPTKG
  TGKSSTLNLRMPIWTDSDGAKVALNGQSLHPSAPGSFLQIANKWSHGDTVTLQLPISLRTEAIKDDRAEYASVQAILYGPVL
Full Sequence
Protein Sequence     Length: 896     Download
MKSFGFVDMP SVFVIFLLCV WGCGFAVGKE CTNSVDSWMQ SHTLRFELLN SNNETLKNEV    60
FSHYHLTPSD DAAWLNLLPR KILREEDEYE WSVMYRKMKH AGGGSEAPGG FLKEVSLHDV    120
RLDPTSQHGK AQQTNLEYLL MLDSDSLLWS FRKTAGLATP GEPYDAKDSW EKPSSELRGH    180
FVGHYLSASA MMWASTHNDT LKEKMSGIVS SLALCQNEIG SGYLSAFPTL EFDKLENITY    240
VWAPYYTIHK ILAGLLDQYT LAGSDQAFSM VKWMVEYFYK RIQNVISKYS IARHYMSLNE    300
EAGGMNDILY KLYTITGDTK HLLLAHLFDK PCFLGLLAVK ADDIAGYHTN THVPVVIGAQ    360
KRYEVTGEPL YKGDVPSLLD MALHLHSSSL HYRLEMGIFF MDIVNSSHTY ATGGTSVSEF    420
WSAPKRLATT LQTENEESCV TYNMLKVSRT LFRWTKEPAY ADFYERALTN GVLGIQRGTE    480
PGVMIYMLPL GSGRSKAISY HGWGSPFDHF WCCYGTGIES FSKLGDSIYF EEEGETPSLY    540
IIQYISSSLD WKSGNVVLNQ TVDNINPWDP YLRITLTFSP TKGTGKSSTL NLRMPIWTDS    600
DGAKVALNGQ SLHPSAPGSF LQIANKWSHG DTVTLQLPIS LRTEAIKDDR AEYASVQAIL    660
YGPVLLAAHT SGDWDLRTKS IDSLSDWITP IPSSYNSYLV SFSQEYENST FALANVNQTI    720
ELDNFPEAGT AASVHATFRL ILDDLSTKVS KAQDAIGKSV MLELFDLPGQ VLGHQGKEKN    780
LVIADSSYSR VKKVFRLVPG LDGKTASISL ESESDNGCFV YSTESEVNAI LKLGCNTDSS    840
NVGFNQAASF VMKSGISQYH PISFVAQGKD RNFLLQPLSS FMDEFYTPYL NITTV*        900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35334.0e-57161673518+
pfam07944DUF16802.0e-137119667557+
Signal Peptide
Cleavage Site
28
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.1Phvul.011G057700.3Phvul.011G057800.1Phvul.005G149100.1
Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny