y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20704.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 1087 Molecular Weight: 123289 Isoelectric Point: 6.8217
ChromosomeChromosome/Scaffold: 1 Start: 17213306 End: 17219310
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57642002.3e-26
  MFVNAGTEDLYESDSGVTFLGDSYFVGGNVLRTNEQIGDGGDYPHIYQSARVGNFSYRFNYLPPGEYYIDIHFTEIINTNGPKGMRVFNVLSDFDIYAIV
  GANKPLQLVDSRVSVKEDGVVVIRFEGVIGSPLVSGI
Full Sequence
Protein Sequence     Length: 1087     Download
MEETQFDPDF QDSEQAQQPN PDLKDSSMDE DDESLVDSML CDSGSRLIPT GFTRPNSTSG    60
EYVMFVNAGT EDLYESDSGV TFLGDSYFVG GNVLRTNEQI GDGGDYPHIY QSARVGNFSY    120
RFNYLPPGEY YIDIHFTEII NTNGPKGMRV FNVLSDFDIY AIVGANKPLQ LVDSRVSVKE    180
DGVVVIRFEG VIGSPLVSGI GIRRPPSDSV TGKIVELLKC NNCDAEIEVS SAQKKLMQKK    240
STAKYEKKIQ ELNTRCELKA KECYEAWMSL TVANEQLDKV RMELDNTAFK TLTQDQAMQK    300
QAEDIRNLSS KYEHDKKYWA AAVNDLQLKI KLMQKEHLHL SREAHACADS IPDLNNMISA    360
VQGLVAECED LKVKYNEEQA KRKKLFNEVQ EAKGNIRVFC RCRPLSKEEI TTGCKAVVDF    420
EAAQDGCLGF VTGASTKKSF KFDRVYTPKD DQADVYVDAS PMVISVLDGY NVCIFAYGQT    480
GTGKTFTMEG TEKNRGVNYR TLEQLFEIAN ERRETFTYNI SVSVLEVYNE QIRDLLDTSP    540
HPSKKLEIKQ APEGSHHVPG IVEAKVESIK EVWSVLQAGS NARAVGSNNV NEHSSRSHCL    600
LCIMVKAKNL INGESTKSKL WLVDLAGSER LAKTDVQGER LKEAQNINRS LSALGDVISA    660
LANKSGHIPY RNSKLTHLLQ DSLGGDSKTL MFVQISPSDK DLGETMSSLN FATRVRGIEL    720
GPVKKQVDTS ELQKTKLMLE RARQEARSKD DSLRKLEENL QNLESKNKGK DQIYKNQQEK    780
IKDLEGKLEL KTALLIQLEK QISQLSDRLR GKEETCSCLK QKELYLMKVE ELEADLRQQQ    840
KSESESANLR QKVKDLQSKL DEQMQESEFI STTLQHKVKE LEIKLKEEEQ KSDPSSLHQK    900
IKELEDKLRE QEKQLTEEKL RVVQEKQLLE EKLREKERQL VEDKLRGQEN QSQCTQVLTE    960
MVRATPHEGK SRIRDEIMND VDPCILRTSN SLNRRMSQGS TLLKGNESVH EKRRKREFKS    1020
GETENFHRLS TSLYDNKSRK SDPPKIARIT RPVKPVTATQ GPLIHKRIIR DQVQVKERDN    1080
KKKIWS*                                                              1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01372KISc_KIF47.0e-103396719344+
cd00106KISc3.0e-122395716330+
smart00129KISc1.0e-137395724337+
pfam00225Kinesin3.0e-140401718327+
cd01366KISc_C_terminal0393721330+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A03927202330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A03827721383A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C03907511359A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A03907511359A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B03907511359A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna26561.1-v1.0-hybrid
Glycine maxGlyma01g02620.1Glyma09g33340.2
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny