y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20734.1-v1.0-hybrid
FamilyAA1
Protein PropertiesLength: 540 Molecular Weight: 59615.1 Isoelectric Point: 4.8786
ChromosomeChromosome/Scaffold: Start: 2284673 End: 2287063
Descriptionlaccase 14
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA12675250
  PFDNTTTTAILRYTNATAPSSIPFPSLPSTTDKESVDNFTSKLKALASEEHPISVPQNITKRIIITVSVNQLPCDLVNGTCGGPQGNRLAASLNNISFST
  PTTDILQQYYSMLNDTSFDSDFPSQPAVVFNFTGDDADDYLLPEVGTKAKLVEYGASVEIVYQGTNIGNAENHPMHLHGYSFYVVGSAYGNWNETTSPDT
  YNLIDPPEVNTVGVPKNGWTAIRFVANNPGVWFMHCHLERHASWGMNTVLIVKNGPTND
AA1272470
  NVHHYSFILKETNFTRLCFEKPMLTVNEQFPGPTIHVRKGDTAFVNVHNDGKYGVTIHWHGVKQPNNPWSDGPENITQCPIQPGKNFTYEVIFSDEEGTL
  WWHAHSDWSRATVHGHIVILPEIGKTYPFPEPYAEQTLFLASWFNTDVKELIDDATLIGGDPDPSDGFTINGWPGALYNCSNETISTFDVEYGKTYLFRL
  VSGVMNEEMFFGIAGHNFTVQ
Full Sequence
Protein Sequence     Length: 540     Download
MEVKKMLGLL FGIFFLDGLF LLAAASNVHH YSFILKETNF TRLCFEKPML TVNEQFPGPT    60
IHVRKGDTAF VNVHNDGKYG VTIHWHGVKQ PNNPWSDGPE NITQCPIQPG KNFTYEVIFS    120
DEEGTLWWHA HSDWSRATVH GHIVILPEIG KTYPFPEPYA EQTLFLASWF NTDVKELIDD    180
ATLIGGDPDP SDGFTINGWP GALYNCSNET ISTFDVEYGK TYLFRLVSGV MNEEMFFGIA    240
GHNFTVQTSL QVPTTLLLVP SLYSGAPFDN TTTTAILRYT NATAPSSIPF PSLPSTTDKE    300
SVDNFTSKLK ALASEEHPIS VPQNITKRII ITVSVNQLPC DLVNGTCGGP QGNRLAASLN    360
NISFSTPTTD ILQQYYSMLN DTSFDSDFPS QPAVVFNFTG DDADDYLLPE VGTKAKLVEY    420
GASVEIVYQG TNIGNAENHP MHLHGYSFYV VGSAYGNWNE TTSPDTYNLI DPPEVNTVGV    480
PKNGWTAIRF VANNPGVWFM HCHLERHASW GMNTVLIVKN GPTNDTKIRP PPPNLPICA*    540
                                                                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_33.0e-4535148116+
PLN02191PLN021911.0e-5144517531+
PLN02604PLN026041.0e-6028515552+
TIGR03388ascorbase6.0e-6544515539+
TIGR03389laccase028538540+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0265161521A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB1asq_A0265161521A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB1asp_B0265161521A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB1asp_A0265161521A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB1aso_B0265161521A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
Transmembrane Domains
StartEnd
729
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00805.1
Brassica rapaBra005698.306.628Bra005698.306.628
Capsella rubellaCarubv10002796m
Citrus sinensisorange1.1g016876m
Eucalyptus grandisEucgr.B00926.1Eucgr.L00618.1Eucgr.C03119.1Eucgr.D00739.2Eucgr.D00739.1
Eucgr.C04047.1Eucgr.F02651.1Eucgr.E04215.1
Fragaria vescamrna17622.1-v1.0-hybridmrna20734.1-v1.0-hybrid.267.525mrna20734.1-v1.0-hybrid.267.525
Linum usitatissimumLus10042249Lus10026401Lus10006157.329.565Lus10006157.329.565
Malus domesticaMDP0000478260MDP0000126274.271.513MDP0000126274.271.513MDP0000192322.262.504MDP0000192322.262.504
MDP0000226556.262.504MDP0000226556.262.504MDP0000139079MDP0000258933.740.941MDP0000258933.740.941
Manihot esculentacassava4.1_011108mcassava4.1_012403m
Medicago truncatulaMedtr3g071890.2
Oryza sativaLOC_Os10g30140.1LOC_Os01g27700.1LOC_Os03g18640.1
Panicum virgatumPavirv00067346m.355.586Pavirv00011031mPavirv00044566mPavirv00002879mPavirv00051916m
Pavirv00063725mPavirv00032843mPavirv00067346m.355.586Pavirv00051097m
Picea abiesMA_97119g0020MA_63042g0010MA_10191230g0010MA_7035458g0010MA_812936g0010
MA_115131g0010MA_8558020g0010MA_73829g0020MA_945295g0010MA_775445g0010
MA_21316g0010.255.559MA_21316g0010.255.559MA_8210355g0010
Populus trichocarpaPotri.013G152700.3
Ricinus communis28644.m000936
Setaria italicaSi034761m.360.589Si034761m.360.589
Sorghum bicolorSb08g000720.1
Vitis viniferaGSVIVT01034822001.347.597GSVIVT01034822001.347.597GSVIVT01012745001GSVIVT01034820001GSVIVT01012746001
GSVIVT01034822001.12.242GSVIVT01034822001.12.242GSVIVT01034833001GSVIVT01013687001.88.319GSVIVT01013687001.88.319
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny