y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20846.1-v1.0-hybrid
FamilyGH28
Protein PropertiesLength: 346 Molecular Weight: 39291.1 Isoelectric Point: 5.0223
ChromosomeChromosome/Scaffold: 7 Start: 16693918 End: 16703611
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281081876.6e-24
  HQMKLVSHLEEAHVSEVVVDGAKLNGTTNGIMIKTWQGGSGNASNITFENIDMHNVTNPIIIDQYYCDSKKPCKEQMQKP
Full Sequence
Protein Sequence     Length: 346     Download
MEGGFRKQEG VVGILAFEVA YVMSKLVPLW DSLSFEQVER DRKFLPNSVG FKKLVHMMPI    60
SSEDFEHAVC DWIDNGVDAF GWKLSSEEMG KEAKKMKSFV SVTGDLYHQM KLVSHLEEAH    120
VSEVVVDGAK LNGTTNGIMI KTWQGGSGNA SNITFENIDM HNVTNPIIID QYYCDSKKPC    180
KEQMQKPISS YWDPVVGDKF KGNSPSRPRT GILLNGTLHW VRRLEDDSQV IVSLCLADEE    240
VRKIPLPIDL GVGEWHALEL RLLFNDSPCI AHSFITEIVD EFTVTSNDEI WVMNEYGVVE    300
SWTKRKSFSA LECSLLPLDA WNMYNLVFQM LKFVMHDHSL WLVYL*                   360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03010PLN030105.0e-1611717862+
PLN02188PLN021882.0e-1711818575+
PLN02218PLN022181.0e-2211818366+
pfam00295Glyco_hydro_281.0e-2411820689+
PLN02793PLN027931.0e-2711918365+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bhe_A0.000003108173251314A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
Hydropathy
Orthologous Group
SpeciesID
Brachypodium distachyonBradi1g04640.1.211.284Bradi1g04640.1.211.284
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny