y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna20901.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 393 Molecular Weight: 42963.7 Isoelectric Point: 9.294
ChromosomeChromosome/Scaffold: 7 Start: 17016703 End: 17017881
DescriptionGlycosyl hydrolase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17483510
  PPLPERVASTVTSLGLAALRLDVSDPNLVRAFLYSNTSLLLTIPNALVPPLAANRTNALRWLYAHVVPFFPRTKIAAISVGNDVLESTPEFSQFLLPAIQ
  NVHLALLDLGIRKIAVSTTFSFVNVVTAPFPPSAAQFIDAPLQTVIRPLLQFLRDTNSSFFVNVYPYNLYRLRSEIPIGFPLFQEHPFSFRDDMATGVRY
  RNLFDMMVDAVISAMAVAGHENIPLIVTETGWPSSSTDPREVEANPVYAELYIKGLLGHLKSGRGTPLRKEGVAQVYIYELIDKQVRLGRNWGILFANMT
  NKYK
Full Sequence
Protein Sequence     Length: 393     Download
MASHFSLSAV SLITLLSLLA ATASPDAVSS TIIGATYSAS TAATYPTPPL PERVASTVTS    60
LGLAALRLDV SDPNLVRAFL YSNTSLLLTI PNALVPPLAA NRTNALRWLY AHVVPFFPRT    120
KIAAISVGND VLESTPEFSQ FLLPAIQNVH LALLDLGIRK IAVSTTFSFV NVVTAPFPPS    180
AAQFIDAPLQ TVIRPLLQFL RDTNSSFFVN VYPYNLYRLR SEIPIGFPLF QEHPFSFRDD    240
MATGVRYRNL FDMMVDAVIS AMAVAGHENI PLIVTETGWP SSSTDPREVE ANPVYAELYI    300
KGLLGHLKSG RGTPLRKEGV AQVYIYELID KQVRLGRNWG ILFANMTNKY KNVDYRSQSD    360
SVLGGLGFFK MVLSQFLIFA FLLRGNAAIS LL*                                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_176.0e-4954350302+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A6e-364935113309A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B2e-355033612284A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A2e-355033612284A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghr_A1e-344935013302A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aq0_B1e-344935013302A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Signal Peptide
Cleavage Site
23
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00773.1
Arabidopsis lyrata486019
Arabidopsis thalianaAT3G55780.1
Brassica rapaBra003281Bra007190
Carica papayaevm.model.supercontig_19.225
Capsella rubellaCarubv10018761m
Citrus clementinaCiclev10033928m
Citrus sinensisorange1.1g035682m
Cucumis sativusCucsa.164630.1
Eucalyptus grandisEucgr.F04056.1
Glycine maxGlyma02g42110.2
Gossypium raimondiiGorai.011G279200.1Gorai.013G019700.1
Linum usitatissimumLus10028258Lus10040232
Malus domesticaMDP0000873928MDP0000878409
Manihot esculentacassava4.1_021110m
Medicago truncatulaMedtr5g081720.1
Mimulus guttatusmgv1a007581m
Phaseolus vulgarisPhvul.008G227100.1
Populus trichocarpaPotri.010G193700.1
Prunus persicappa021891m
Ricinus communis29610.m000404
Thellungiella halophilaThhalv10006375mThhalv10005331mThhalv10006480mThhalv10010910m
Vitis viniferaGSVIVT01016379001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny