y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21040.1-v1.0-hybrid
FamilyGH85
Protein PropertiesLength: 721 Molecular Weight: 81413.2 Isoelectric Point: 7.0116
ChromosomeChromosome/Scaffold: 7 Start: 17707156 End: 17711669
DescriptionGlycosyl hydrolase family 85
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH851063630
  MAGGYGDDKWIQGGTNPDAYSIWNWYLIDVFIYFSHSLVALPPPCWTNTAHKHGVKVLGTFITEWEEGKRVCNKLLSTKESAEMYAERLVELAVALGFDG
  WLINMEVELELGQIPNLKAFVSYLTERMHSAVTGSLVIWYDSVTTDGKLNWQNQLNEKNKPFFDISDGIFVNYTWEKNYPKQSAVVAGDRKFDVYMGIDV
  FGRGTFGGGQWNTSVALDVLKNDGVSAAIFAPGWIYETNQPPNFQTAQNHWWTLVEKS
Full Sequence
Protein Sequence     Length: 721     Download
MLLRLLRAYI RRETLASLLK PLRLIRQTFL LFFKMSQPNP PQPSAPTPPP FDPTRPAIPI    60
SYPIKTLEDL ESRSYFDSFH FPFNKSSVPL RSGLPNRPRL IVCHDMAGGY GDDKWIQGGT    120
NPDAYSIWNW YLIDVFIYFS HSLVALPPPC WTNTAHKHGV KVLGTFITEW EEGKRVCNKL    180
LSTKESAEMY AERLVELAVA LGFDGWLINM EVELELGQIP NLKAFVSYLT ERMHSAVTGS    240
LVIWYDSVTT DGKLNWQNQL NEKNKPFFDI SDGIFVNYTW EKNYPKQSAV VAGDRKFDVY    300
MGIDVFGRGT FGGGQWNTSV ALDVLKNDGV SAAIFAPGWI YETNQPPNFQ TAQNHWWTLV    360
EKSWGITQNY PIVLPFYSNF DQVKPFYKYK TYQGHGYHVS KEGRQVSDSS WCNISSQSFQ    420
PLLPFTDNSA PDGIEVHVEE ASYSGGGNIT FKGNLKDNAD FTARLFQGHL LLGDLPLHFT    480
YSVKSENNSR LGLFLSFVST LNKKKSVLLV SWNSHQFSSK FGTVIRTRQL EKPGTAPGWV    540
IEESSIRMKG HILTEIHALC YRSKPEFDER IPKSKSSQDD SCAHNSTEYY AVLGHISMKS    600
CGHNSVFPPS DMWLVQGQYI QWTTGSEDTK YLSLKITWKM KDGNDSEFST YNIYVEKLAE    660
GKLKGEQSYL GVARVEAFYV YDLATSSDTS SIKFIIQVCG GDGSSQKLDD SPVFLLDTAA    720
*                                                                    780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00598GH18_chitinase-like1.0e-5106236143+
COG4724COG47246.0e-3883496462+
pfam03644Glyco_hydro_857.0e-118106398312+
cd06547GH85_ENGase2.0e-133101425345+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fha_D8e-278249328460A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_C8e-278249328460A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_B8e-278249328460A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_A8e-278249328460A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_F1e-2613049384460A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1
Glyma14g06120.1Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny