y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21306.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 301 Molecular Weight: 32340 Isoelectric Point: 8.8279
ChromosomeChromosome/Scaffold: 7 Start: 17938838 End: 17940031
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA21182811.1e-29
  LGGPSWQVYLGRRDSTSASRSAASTSIPPPASNISSLLSSFAAQGLSLRDLVALSGSHTIGLARCTSFRARIYKDTTTDAVFAKSLQSNCPVTGNDNNLA
  SLDLQTPTYFDNLYYKNLLKEKGLLHSDQELFNGTPADAMVKLYASNTFAFFYDFANSMVKMGN
Full Sequence
Protein Sequence     Length: 301     Download
MVSYKLLLLG LVFAGAVLQS INGKLSPTSY LPRCPNALSI VQDEVIAAIK NERRIGASLL    60
RLHFHDCFVN GCDASVLLDD TPGFIGEKTA VPNNNSLGGF EVVDRIKAKV EKACPGVLGG    120
PSWQVYLGRR DSTSASRSAA STSIPPPASN ISSLLSSFAA QGLSLRDLVA LSGSHTIGLA    180
RCTSFRARIY KDTTTDAVFA KSLQSNCPVT GNDNNLASLD LQTPTYFDNL YYKNLLKEKG    240
LLHSDQELFN GTPADAMVKL YASNTFAFFY DFANSMVKMG NIKPLTGSQG EIRINCRKVN    300
*                                                                    360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00123326432+
cd00314plant_peroxidase_like2.0e-1939281287+
pfam00141peroxidase1.0e-4041179156+
PLN03030PLN030306.0e-5430300300+
cd00693secretory_peroxidase1.0e-13224299300+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0243001294A Chain A, Peanut Peroxidase
PDB1sch_A0243001294A Chain A, Peanut Peroxidase
PDB1qo4_A0243002304A Chain A, Peanut Peroxidase
PDB1pa2_A0243002304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B0233002305A Chain A, Raphanus Sativus Anionic Peroxidase.
Signal Peptide
Cleavage Site
23
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00142.1Aquca_029_00102.1
Brachypodium distachyonBradi4g44510.1Bradi5g00690.1
Citrus sinensisorange1.1g022375morange1.1g025013m
Fragaria vescamrna28146.1-v1.0-hybrid
Linum usitatissimumLus10030145.156.325Lus10030145.156.325
Medicago truncatulaMedtr3g072210.1
Oryza sativaLOC_Os03g22010.3LOC_Os12g02080.2
Panicum virgatumPavirv00064327mPavirv00026915mPavirv00051402mPavirv00019628m
Picea abiesMA_414832g0010MA_10433993g0010MA_19749g0010MA_10430578g0010MA_91956g0010
MA_746078g0010MA_74610g0010
Populus trichocarpaPotri.013G156500.1.166.334Potri.013G156500.1.166.334
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny