y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21487.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 374 Molecular Weight: 40762.4 Isoelectric Point: 8.3525
ChromosomeChromosome/Scaffold: 7 Start: 8737314 End: 8739785
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82603729.9e-36
  VIVSPHGDDNFTSIGAAIDSAPNNTNPEDGYFVIYARKGHYKEYVVVPKYKKNIMLLGDGINKTIITGKHNFVDGWTTFNSSTFAVSGERFVAIDVTFKN
  TAGPEKHQAVAMQ
Full Sequence
Protein Sequence     Length: 374     Download
MPTPPQSLSL LLLLLALPLL IFCFPAEAES PPSPPSSSAS AACKSTLYPK LCRSILSAIR    60
SSPSDPYNYG KFSIKQCLKK ARKLSKALDH FLHHTKLSSS MTDAEANAFD DCQQLSELNV    120
DYLEAISTEL KSAELLNEEL VDKVQTLLSG IVTNQQTCYD GLVVAKSSIV NSSTSPLSVA    180
FSNATQLYSV SLGLVTHSLA RNLKKKHKKR NGSSVSQGHK IREPLETFIE GLRKSSSKHS    240
RDERILDEME SSGIIVNDAV IVSPHGDDNF TSIGAAIDSA PNNTNPEDGY FVIYARKGHY    300
KEYVVVPKYK KNIMLLGDGI NKTIITGKHN FVDGWTTFNS STFAVSGERF VAIDVTFKNT    360
AGPEKHQAVA MQF*                                                      420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02416PLN024162.0e-3943372333+
PLN02468PLN024682.0e-4043371330+
pfam01095Pectinesterase4.0e-41260370111+
PLN02713PLN027139.0e-8943372338+
PLN03043PLN030437.0e-17043372337+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A3e-242603729118A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A2e-212543721114B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A0.000225735932133A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
28
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00168.2Aquca_013_00088.2
Arabidopsis lyrata333607.265.369333607.265.369
Citrus sinensisorange1.1g045655morange1.1g041181m
Gossypium raimondiiGorai.009G039100.2Gorai.008G143800.2.252.335Gorai.008G143800.2.252.335
Linum usitatissimumLus10001466Lus10029867Lus10020679Lus10037458
Medicago truncatulaMedtr1g088290.1.243.374Medtr1g088290.1.243.374
Panicum virgatumPavirv00064468m
Picea abiesMA_8928694g0010MA_10428884g0010MA_5090144g0010MA_86577g0010.189.276MA_9819944g0010
MA_86577g0010.189.276
Populus trichocarpaPotri.002G202500.2.247.357Potri.002G202500.2.247.357
Ricinus communis30190.m010812.219.33130190.m010812.219.331
Setaria italicaSi001381m.139.287Si001381m.139.287
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny