y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21629.1-v1.0-hybrid
FamilyGH9
Protein PropertiesLength: 269 Molecular Weight: 29697.6 Isoelectric Point: 6.1599
ChromosomeChromosome/Scaffold: 3 Start: 3470728 End: 3471534
Descriptionglycosyl hydrolase 9B6
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9352620
  NYADALSKSILFLEGQRSGPLPRTQRVTWRKDSALHDGNDVHMDLVGGYYDAGDNVKFNFPLAFTTTMLSWSVLEFRGSMGSELPHALEAIRWGTDYLLK
  STDASGSVVGVVGDPIGDHTCWQRPEDMDTPRTSYIVTREKPGTEVSAETAAALAASSMVFRGRYSARLLDRAKVVFEFADKYRGSYNDSIGEAACPFYC
  DFNGYMDELIWGASWLYKATKESILLDL
Full Sequence
Protein Sequence     Length: 269     Download
MLRRNLQHQL RLLILAALGV LAIATLARSA TPSHNYADAL SKSILFLEGQ RSGPLPRTQR    60
VTWRKDSALH DGNDVHMDLV GGYYDAGDNV KFNFPLAFTT TMLSWSVLEF RGSMGSELPH    120
ALEAIRWGTD YLLKSTDASG SVVGVVGDPI GDHTCWQRPE DMDTPRTSYI VTREKPGTEV    180
SAETAAALAA SSMVFRGRYS ARLLDRAKVV FEFADKYRGS YNDSIGEAAC PFYCDFNGYM    240
DELIWGASWL YKATKESILL DLCQAEHA*                                      300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026137.0e-9130261237+
PLN03009PLN030094.0e-9228264243+
pfam00759Glyco_hydro_91.0e-10035257228+
PLN02308PLN023089.0e-10429255230+
PLN02266PLN022665.0e-10933265236+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0332652237A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1ksc_A0332652237A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1ks8_A0332652237A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0322672240A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0322672240A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
1231
Signal Peptide
Cleavage Site
29
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00114.1.21.201Aquca_013_00114.1.21.201Aquca_017_00132.3
Carica papayaevm.model.supercontig_183.4.29.235
Eucalyptus grandisEucgr.E01718.1.36.217Eucgr.E01718.1.36.217
Linum usitatissimumLus10025880.34.183Lus10025880.34.183Lus10030008
Manihot esculentacassava4.1_004404m.27.206cassava4.1_004404m.27.206cassava4.1_023568m
Medicago truncatulaMedtr5g093590.1.34.150Medtr5g093590.1.34.150
Panicum virgatumPavirv00051820m
Picea abiesMA_8118797g0010MA_62382g0010MA_10430095g0010.32.209MA_54112g0010.32.180MA_54112g0010.32.180
MA_501421g0010MA_79718g0010MA_169910g0010MA_863320g0010MA_10430095g0010.32.209
MA_10349916g0010.64.241MA_10349916g0010.64.241MA_10241783g0010.37.216MA_10241783g0010.37.216MA_20530g0010.13.192
MA_20530g0010.13.192MA_10694g0010MA_107238g0010.91.354MA_107238g0010.91.354
Populus trichocarpaPotri.014G044400.1Potri.004G161900.1
Ricinus communis30190.m010828
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny