y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21630.1-v1.0-hybrid
FamilyGH9
Protein PropertiesLength: 198 Molecular Weight: 21280.2 Isoelectric Point: 7.123
ChromosomeChromosome/Scaffold: 3 Start: 3471605 End: 3472198
Descriptionglycosyl hydrolase 9B1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9111912.90069e-43
  TNSDQLVCSILPESPAPKSVTYSPGGLLFKLGGSNLQHATSLSFLLTAYANYMKAADKVVNCGNNVVITPSRLINFTKGQVDYILGSNPLGMSYMVGYGS
  KFPKRIHHRASVLPSMDQHPAQIECHAGTPYFETQAPNQNLLIGAIVGGPAENDSFEDSRYNVPQSEPTTYINAPFVGVLA
Full Sequence
Protein Sequence     Length: 198     Download
MVNIDNSPFI TNSDQLVCSI LPESPAPKSV TYSPGGLLFK LGGSNLQHAT SLSFLLTAYA    60
NYMKAADKVV NCGNNVVITP SRLINFTKGQ VDYILGSNPL GMSYMVGYGS KFPKRIHHRA    120
SVLPSMDQHP AQIECHAGTP YFETQAPNQN LLIGAIVGGP AENDSFEDSR YNVPQSEPTT    180
YINAPFVGVL AHFKSLS*                                                  240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026135.0e-589191185+
PLN02175PLN021755.0e-641195197+
PLN03009PLN030099.0e-7612193182+
PLN02266PLN022661.0e-7712193182+
PLN02308PLN023084.0e-819195187+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ia7_A1e-1630191291424A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB1ia6_A1e-1630191291424A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
PDB1ksd_A2e-1633196291431A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
PDB1ksc_A2e-1633196291431A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
PDB1ks8_A2e-1633196291431A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Hydropathy
Orthologous Group
SpeciesID
Brachypodium distachyonBradi3g56870.1
Citrus sinensisorange1.1g019436m.12.195orange1.1g045046m.271.412orange1.1g045046m.271.412orange1.1g043973m
Linum usitatissimumLus10025880.184.443Lus10025880.184.443Lus10010307.382.492Lus10010307.382.492
Malus domesticaMDP0000322418MDP0000151410
Medicago truncatulaMedtr4g037140.1
Panicum virgatumPavirv00065976m
Picea abiesMA_107238g0010.352.456MA_107238g0010.352.456MA_10430095g0010.237.398MA_10430095g0010.237.398
Ricinus communis30131.m007125.321.42330131.m007125.321.42328865.m000016
Vitis viniferaGSVIVT01019379001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny