y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21640.1-v1.0-hybrid
FamilyGH28
Protein PropertiesLength: 978 Molecular Weight: 109607 Isoelectric Point: 7.0134
ChromosomeChromosome/Scaffold: 3 Start: 3524561 End: 3530339
Descriptionthreonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH287469620
  LFHINVINSKHLTLQRITIDAPQESLNTDGIHIGRSSYINVTDANIKTGDDCVSLGDGSQNINVEKVTCGSGHGISIGSLGRYHDEQPVQGVTVRYCQIS
  NTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPVLVDQEYCPYGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINLTYN
  GNKNGTAISECANVKPT
Full Sequence
Protein Sequence     Length: 978     Download
MATTSSSLLS SPLLKPSSFL SPLKRCVSQP TSDFRAFAFS RNGLSTSAAA VAATEPHVST    60
QHDKLKEAQK DKSDKLDRVV LPSNESSEKL LRIRHTCAHV MAMAVQKLYP DAKVTIGPWI    120
ENGFYYDFDM EPLTDKELKR IKKEMDRIIC RNLPLVREEV SREEAQRRIS TLNEPYKLEI    180
LDSIKDDPIT IYHIGNEWWD LCAGPHVEYT GKINRKAVEL ESIAGAYWRG DEKKPMLQRI    240
YGTAWENEEQ LQAYLHFKEE AKRRDHRRLG QVLDLFSIQF EFLQNDAGGG LVFWHPKGAI    300
VRHVIEDLWK KTHIERGYDL LYTPHVAKAD LWQISGHLDF YRENMYNQMD VEDELYQLRP    360
MNCPYHILIY KRRRHSYNDF PIRVAELGTV YRYELSGSLH GLFRVRGFTQ DDAHIFCLED    420
QIKDEIRGVL DLTEELLLKF GFSKYEVNLS TRPEKSVGDD DIWEKATSAL RDALEDKGWS    480
YQIDDGGGAF YGPKIDLKIE DALGRKWQCS TIQASPEQKK RPIMIHRAVL GSLERFFGVL    540
IEHYAGDFPL WLSPVQAHVL PVTDTQLDYC KELTNKLKVS GIRGELCHGE RLPKLIRNSE    600
MLKIPLMAVV GAKEVESGTV TVRSRSGDDP GTMSIDDFVT FSLTANAADF DVRKYGAKAD    660
GKTDDSQAIN KAWTDACTAT SQSTVVIEKR NYLVGPVRFG GPCKAPISIK VAGTLVAPAE    720
PEKLKSQDGW VVFQNVDNLS VFGGKLFHIN VINSKHLTLQ RITIDAPQES LNTDGIHIGR    780
SSYINVTDAN IKTGDDCVSL GDGSQNINVE KVTCGSGHGI SIGSLGRYHD EQPVQGVTVR    840
YCQISNTTNG VRIKTWPASP NGVASDLHFE DISMDNVKTN PVLVDQEYCP YGQCQAKLPS    900
KVKISNVSFK NIRGTTQDLV AVKLVCSRGI PCQNVQVADI NLTYNGNKNG TAISECANVK    960
PTVSGFNHPQ VCAKNVA*                                                  1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02837PLN02837048640607+
PRK12305thrS085647580+
PRK00413thrS070639590+
COG0441ThrS074639582+
TIGR00418thrS094639564+
Gene Ontology
GO TermDescription
GO:0000166nucleotide binding
GO:0004650polygalacturonase activity
GO:0004812aminoacyl-tRNA ligase activity
GO:0005524ATP binding
GO:0005737cytoplasm
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qf6_A08863966625A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna
PDB1nyr_B07963961632A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna
PDB1nyr_A07963961632A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna
PDB1nyq_B07963961632A Chain A, Structure Of Staphylococcus Aureus Threonyl-trna Synthetase Complexed With An Analogue Of Threonyl Adenylate
PDB1nyq_A07963961632A Chain A, Structure Of Staphylococcus Aureus Threonyl-trna Synthetase Complexed With An Analogue Of Threonyl Adenylate
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00345.1Aquca_014_00346.1Aquca_017_00129.1Aquca_007_00950.1Aquca_001_00543.1
Aquca_017_00127.1Aquca_017_00128.2Aquca_017_00128.1Aquca_005_00082.1Aquca_005_00081.1
Aquca_019_00042.1Aquca_019_00045.1Aquca_003_00665.1Aquca_012_00088.1Aquca_017_00128.3
Aquca_016_00178.1Aquca_035_00221.1Aquca_023_00138.1Aquca_023_00144.1Aquca_013_00893.1
Aquca_019_00043.1
Arabidopsis lyrata887420329713497387318190478122
478120494865478121870890877955
894135486450483504903793903792
887757887756902380471917882030
863554870473870469
Arabidopsis thalianaAT1G02790.1AT4G18180.1AT3G14040.1AT3G07850.1AT5G48140.1
AT3G07820.1AT3G07830.1AT3G07840.1AT1G78400.1AT2G43860.1
AT2G15460.1AT1G65570.1AT3G59850.1AT2G43870.1AT2G43890.1
AT1G05660.1AT2G43880.1AT1G05650.1AT2G33160.1AT1G17150.1
AT2G15450.1AT1G43090.1AT1G43080.1AT1G43100.1AT2G15470.1
AT2G40310.1AT4G13760.1AT2G26620.1
Brachypodium distachyonBradi1g36100.1Bradi2g13740.1Bradi3g20537.1Bradi3g42120.1Bradi3g07120.1
Bradi2g57427.1Bradi1g36110.1Bradi1g36090.1Bradi1g40990.1
Brassica rapaBra010872Bra010873Bra032585Bra033347Bra012613
Bra030510Bra001270Bra040032Bra001268Bra035034
Bra029682Bra037431Bra020716Bra037509Bra040035
Bra040034Bra001269Bra029683Bra025997Bra004119
Bra040790Bra007483Bra000332Bra037678Bra000331
Bra004791Bra037676Bra004789Bra037677Bra030619
Bra015446Bra004790Bra021830Bra022928Bra000183
Bra000645Bra014753Bra004111Bra017014Bra037680.252.476
Bra037680.252.476Bra015210Bra000327Bra037680.58.254Bra037680.58.254
Bra037679
Carica papayaevm.model.supercontig_151.22evm.model.supercontig_12.214evm.model.supercontig_50.155evm.model.supercontig_48.188evm.model.supercontig_1615.1
evm.model.supercontig_64.7evm.model.supercontig_64.6evm.model.supercontig_250.6evm.model.supercontig_250.7evm.model.supercontig_14.219
evm.model.supercontig_250.4evm.model.supercontig_250.3evm.model.supercontig_48.187evm.model.supercontig_136.8evm.model.supercontig_333.3
Capsella rubellaCarubv10012094mCarubv10006680mCarubv10015686mCarubv10027711mCarubv10015950m
Carubv10015428mCarubv10015541mCarubv10021845mCarubv10025146mCarubv10007695m
Carubv10022424mCarubv10017416mCarubv10024765mCarubv10025465mCarubv10024902m
Carubv10024718mCarubv10011292mCarubv10012375mCarubv10024590mCarubv10024886m
Carubv10022383mCarubv10012276mCarubv10016541mCarubv10011686m
Citrus clementinaCiclev10023712mCiclev10004345m.90.360Ciclev10004345m.90.360Ciclev10023493mCiclev10015423m
Ciclev10004345m.455.780Ciclev10004345m.455.780Ciclev10017883mCiclev10006970m
Citrus sinensisorange1.1g039959morange1.1g043757morange1.1g047315morange1.1g015254morange1.1g045893m
orange1.1g042768morange1.1g043588morange1.1g048431morange1.1g045402morange1.1g041993m
orange1.1g041973morange1.1g046411morange1.1g037377morange1.1g036371morange1.1g047296m
orange1.1g047322morange1.1g027251morange1.1g027435morange1.1g040962morange1.1g036262m
Cucumis sativusCucsa.252840.1Cucsa.205370.1Cucsa.205400.1Cucsa.205410.1Cucsa.388450.1
Cucsa.099870.1Cucsa.099870.2Cucsa.100520.1Cucsa.295580.1Cucsa.124080.1
Cucsa.277280.1Cucsa.357430.1Cucsa.252830.1Cucsa.086360.1Cucsa.237900.1
Cucsa.167020.1Cucsa.181040.1Cucsa.042430.1Cucsa.180960.1Cucsa.100530.1
Cucsa.143900.1Cucsa.056540.1Cucsa.138430.1Cucsa.027780.1Cucsa.138440.1
Cucsa.150180.1Cucsa.033910.1Cucsa.114180.1Cucsa.034590.1Cucsa.291530.1
Cucsa.356350.1Cucsa.042440.1Cucsa.071480.1Cucsa.181130.1Cucsa.205390.1
Eucalyptus grandisEucgr.H01890.1Eucgr.H01889.1Eucgr.L02033.1Eucgr.H01088.1Eucgr.B01575.1
Eucgr.K00666.1Eucgr.L01551.1Eucgr.K00665.1Eucgr.L01230.1Eucgr.L03464.1
Eucgr.L03153.1Eucgr.K00662.1Eucgr.A01068.1Eucgr.A01065.1Eucgr.C02251.1
Eucgr.K00664.1Eucgr.C02249.1Eucgr.H03964.1Eucgr.K00661.1Eucgr.H00254.1
Eucgr.L01949.1Eucgr.L01371.1Eucgr.H00252.1Eucgr.L00823.1Eucgr.H00255.1
Eucgr.H00253.1Eucgr.J01077.1Eucgr.H00250.1Eucgr.H01886.1Eucgr.A00432.1
Eucgr.L00826.1Eucgr.F00633.1Eucgr.F00632.1Eucgr.F00634.1Eucgr.H00251.1
Eucgr.L03486.1Eucgr.H05001.1
Fragaria vescamrna20228.1-v1.0-hybridmrna07055.1-v1.0-hybridmrna11078.1-v1.0-hybridmrna17351.1-v1.0-hybridmrna27787.1-v1.0-hybrid
mrna14305.1-v1.0-hybridmrna21632.1-v1.0-hybridmrna23948.1-v1.0-hybridmrna01127.1-v1.0-hybridmrna21638.1-v1.0-hybrid
mrna01445.1-v1.0-hybridmrna04439.1-v1.0-hybridmrna19487.1-v1.0-hybrid.66.392mrna19487.1-v1.0-hybrid.66.392mrna02341.1-v1.0-hybrid
mrna19487.1-v1.0-hybrid.453.786mrna19487.1-v1.0-hybrid.453.786mrna03511.1-v1.0-hybridmrna17837.1-v1.0-hybridmrna10145.1-v1.0-hybrid
mrna31694.1-v1.0-hybridmrna31695.1-v1.0-hybridmrna31696.1-v1.0-hybridmrna10147.1-v1.0-hybridmrna21420.1-v1.0-hybrid
mrna10146.1-v1.0-hybridmrna07354.1-v1.0-hybridmrna14928.1-v1.0-hybridmrna20575.1-v1.0-hybridmrna14927.1-v1.0-hybrid
mrna04504.1-v1.0-hybridmrna23301.1-v1.0-hybrid
Glycine maxGlyma15g16240.2Glyma09g04640.2Glyma02g01980.1Glyma07g37440.1Glyma14g00930.2
Glyma14g00930.1Glyma06g22890.1Glyma04g30870.1Glyma04g30920.2Glyma04g30950.1
Glyma18g22430.1Glyma14g37030.1Glyma06g22030.1Glyma02g47720.1Glyma08g15840.1
Glyma03g24030.1Glyma20g02840.1Glyma15g13360.1Glyma09g02460.2Glyma07g34990.2
Glyma01g18520.1Glyma15g23310.1Glyma09g10500.1Glyma10g02120.2Glyma15g42420.2
Glyma15g16251.1Glyma02g38980.2
Gossypium raimondiiGorai.011G222300.1Gorai.005G061900.1Gorai.006G260500.1Gorai.006G076800.1Gorai.006G260500.2
Gorai.007G167600.1Gorai.001G193800.1Gorai.010G091200.1Gorai.006G016500.1Gorai.011G193300.1
Gorai.008G013400.1Gorai.002G038500.1Gorai.002G056900.1Gorai.013G003900.1Gorai.013G004900.1
Gorai.013G004100.1Gorai.011G222200.1Gorai.013G004800.1Gorai.011G222400.1Gorai.012G120000.1
Gorai.006G186600.1Gorai.013G004000.1Gorai.001G098100.1Gorai.002G057100.1Gorai.008G013400.3
Gorai.008G013400.2
Linum usitatissimumLus10016823Lus10003782Lus10012489Lus10039154Lus10009606
Lus10016824Lus10009605Lus10013784Lus10013780Lus10041059
Lus10041058Lus10043088Lus10003001Lus10002123Lus10011419
Lus10002125Lus10011418Lus10002124Lus10002126Lus10022530
Lus10010584Lus10008343Lus10005304Lus10026183Lus10042483
Lus10043087Lus10026184Lus10011417Lus10006167
Malus domesticaMDP0000498407MDP0000261960MDP0000221383MDP0000582836MDP0000261959
MDP0000263137MDP0000286230MDP0000223959MDP0000307094MDP0000859246
MDP0000247298MDP0000524522MDP0000432773MDP0000230434MDP0000163058
MDP0000263272MDP0000235201MDP0000190165MDP0000853065MDP0000516623
MDP0000524876MDP0000845685MDP0000615684MDP0000191453MDP0000169108
MDP0000273194MDP0000260203MDP0000845683MDP0000176123MDP0000247300
MDP0000447149
Manihot esculentacassava4.1_032966mcassava4.1_027290mcassava4.1_029456mcassava4.1_033867mcassava4.1_031726m
cassava4.1_031743mcassava4.1_026629mcassava4.1_027590mcassava4.1_027889mcassava4.1_031143m
cassava4.1_025978mcassava4.1_027894mcassava4.1_026609mcassava4.1_026297mcassava4.1_030897m
cassava4.1_022005mcassava4.1_030943mcassava4.1_031277mcassava4.1_033821mcassava4.1_025673m
cassava4.1_026560mcassava4.1_025157mcassava4.1_021864mcassava4.1_021791mcassava4.1_030301m
cassava4.1_028376mcassava4.1_023138mcassava4.1_020879mcassava4.1_032576mcassava4.1_028825m
cassava4.1_026411mcassava4.1_030991mcassava4.1_030858mcassava4.1_027487mcassava4.1_024357m
cassava4.1_034065mcassava4.1_029037mcassava4.1_029297m
Medicago truncatulaMedtr1g088160.1Medtr2g058840.1Medtr2g058670.1Medtr2g058640.1Medtr4g083660.1
Medtr2g029170.1Medtr2g049400.1Medtr5g097860.1Medtr5g063430.1
Mimulus guttatusmgv1a007314mmgv1a026431mmgv1a007104mmgv1a020057mmgv1a019884m
mgv1a023133mmgv1a007528mmgv1a007545mmgv1a007538mmgv1a007536m
mgv1a007533mmgv1a007768mmgv1a023860mmgv1a023303mmgv1a025544m
mgv1a018101mmgv1a021627mmgv1a019967mmgv1a023780mmgv1a025431m
mgv1a022372mmgv1a017666mmgv1a023900mmgv1a008791mmgv1a012335m
Oryza sativaLOC_Os06g31270.1LOC_Os01g33300.1LOC_Os06g40880.1LOC_Os06g35370.1LOC_Os06g35320.1
LOC_Os06g40890.1LOC_Os02g10300.1LOC_Os01g43490.1LOC_Os01g66710.1LOC_Os11g14410.1
LOC_Os08g23790.1LOC_Os06g35300.1LOC_Os11g14400.1
Panicum virgatumPavirv00035134mPavirv00034360mPavirv00055614mPavirv00040368mPavirv00022526m
Pavirv00010684mPavirv00044011mPavirv00046761mPavirv00005355mPavirv00005092m
Pavirv00069057mPavirv00058217mPavirv00024858mPavirv00015323mPavirv00028286m
Pavirv00007502mPavirv00035135mPavirv00034359mPavirv00042409mPavirv00018555m
Phaseolus vulgarisPhvul.003G107500.1Phvul.009G251500.1Phvul.007G218300.1Phvul.008G286900.1Phvul.004G097300.1
Phvul.007G076900.1Phvul.007G077000.1Phvul.002G100400.1Phvul.008G143500.1Phvul.010G039000.1
Phvul.007G076800.1Phvul.007G076600.1Phvul.005G039700.1Phvul.007G076400.1
Picea abiesMA_13282g0010
Populus trichocarpaPotri.010G007300.1Potri.010G011100.1Potri.010G011200.1Potri.002G202100.1Potri.002G202200.1
Potri.009G169100.1Potri.009G038100.1Potri.019G067200.1Potri.019G067100.1Potri.019G067000.1
Potri.019G066800.1Potri.019G066700.1Potri.014G162300.1Potri.007G035800.1Potri.T177500.1
Potri.T170900.1Potri.010G177600.1Potri.T171000.1Potri.010G248200.1Potri.017G004500.1
Potri.017G003500.1Potri.007G144200.1Potri.007G144400.1Potri.017G005300.1Potri.017G005600.1
Potri.017G005900.1Potri.007G144100.1Potri.T075100.1Potri.007G144500.1Potri.008G010700.1
Potri.017G006200.1Potri.017G005800.1Potri.017G004700.1Potri.017G006700.1Potri.007G145300.1
Potri.017G006500.1Potri.017G006400.1Potri.007G144400.2Potri.019G066800.2Potri.001G377700.1
Prunus persicappa018682mppa016722mppa026115mppa015208mppa015568m
ppa019563mppa018308mppa025464mppa021953mppa007271m
ppa025787mppa006839mppa006857mppa025098mppa016502m
ppa018149mppa020072mppa017135m
Ricinus communis29726.m00409029769.m0046629986.m00164929769.m00046130042.m000469
29738.m00100530042.m00046830042.m00047030042.m00046730042.m000474
30042.m00047530042.m00047630042.m00047230042.m000473
Setaria italicaSi007823mSi015137mSi015477mSi004860mSi017418m
Si006535mSi004836mSi005178mSi006532mSi028218m
Si039581mSi008011m
Sorghum bicolorSb10g024020.1Sb07g016970.1Sb04g006610.1Sb07g025130.1Sb03g021050.1
Sb10g003580.1Sb03g042350.1Sb03g028380.1Sb10g024010.1Sb10g021590.1
Sb10g024000.1
Thellungiella halophilaThhalv10007721mThhalv10027030mThhalv10020501mThhalv10004361mThhalv10020916m
Thhalv10020872mThhalv10005587mThhalv10020866mThhalv10018650mThhalv10001794m
Thhalv10018672mThhalv10006416mThhalv10001491mThhalv10001486mThhalv10001483m
Thhalv10001484mThhalv10007830mThhalv10028169mThhalv10017763mThhalv10027416m
Thhalv10009641mThhalv10017738mThhalv10009339m
Vitis viniferaGSVIVT01035103001GSVIVT01028044001GSVIVT01035102001GSVIVT01030023001GSVIVT01030017001
GSVIVT01020792001GSVIVT01020794001GSVIVT01012232001GSVIVT01030018001GSVIVT01030030001
GSVIVT01004006001GSVIVT01004007001GSVIVT01038241001GSVIVT01038243001GSVIVT01006443001
GSVIVT01023861001.76.261GSVIVT01023861001.76.261GSVIVT01020791001GSVIVT01030031001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)