y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21954.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 291 Molecular Weight: 31825.9 Isoelectric Point: 6.8007
ChromosomeChromosome/Scaffold: 6 Start: 10744973 End: 10746060
Descriptionbeta-1,3-glucanase 3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17121191.8e-36
  IGVCYGTKGDNLPPAQEVISMFDQYGIQKIRLYDPYQGALQALRGSNIEVMLGVENDRLQYISSSQDEANSWVQSNVVSYGNVNFKYIVVGNEIDPTGPQ
  ASFVAPAN
GH171552890
  QKDHSINIEYALFTSPSPVVHDGQLGYQNLFDAILDTVYSALERAGSGSVSILVSESGWPSAGGDGEVTTMANARIYNSNLINHVKSNGTPKKPGSPIEA
  YIFAMFNENQKPGPETERHWGLFYPTKQPKYPIDF
Full Sequence
Protein Sequence     Length: 291     Download
MASIATTAGS KIGVCYGTKG DNLPPAQEVI SMFDQYGIQK IRLYDPYQGA LQALRGSNIE    60
VMLGVENDRL QYISSSQDEA NSWVQSNVVS YGNVNFKYIV VGNEIDPTGP QASFVAPANG    120
KHYKKQLLLR ILPERSKSPL PFPPLSLKNP LTLHQKDHSI NIEYALFTSP SPVVHDGQLG    180
YQNLFDAILD TVYSALERAG SGSVSILVSE SGWPSAGGDG EVTTMANARI YNSNLINHVK    240
SNGTPKKPGS PIEAYIFAMF NENQKPGPET ERHWGLFYPT KQPKYPIDFN *             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53095.0e-72278296+
pfam00332Glyco_hydro_173.0e-3412118108+
pfam00332Glyco_hydro_177.0e-62159289131+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3f55_D0112901316A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB3f55_C0112901316A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB3f55_B0112901316A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB3f55_A0112901316A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB3em5_D0112901316A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata326432.33.170326432.33.170910092
Brassica rapaBra014643Bra014639
Carica papayaevm.model.supercontig_49.128.28.175evm.model.supercontig_49.128.28.175evm.model.supercontig_49.126
Citrus sinensisorange1.1g038030morange1.1g046781morange1.1g046740m
Fragaria vescamrna21954.1-v1.0-hybrid.12.119mrna21954.1-v1.0-hybrid.12.119mrna05671.1-v1.0-hybrid.102.226mrna05671.1-v1.0-hybrid.102.226
Glycine maxGlyma11g10061.1.17.94Glyma11g10061.1.17.94Glyma03g28841.1
Gossypium raimondiiGorai.008G159300.2.29.126Gorai.008G159300.2.29.126Gorai.010G003400.1.49.154Gorai.010G003400.1.49.154
Malus domesticaMDP0000609149.30.144MDP0000247130.167.242MDP0000247130.167.242MDP0000577118MDP0000275579
MDP0000281216MDP0000609149.30.144
Manihot esculentacassava4.1_023209m
Medicago truncatulaMedtr2g034440.2.22.152Medtr2g034440.2.22.152
Panicum virgatumPavirv00034981m
Picea abiesMA_1006327g0010MA_837697g0010MA_6944718g0010MA_10383303g0010MA_219456g0010.27.188
MA_9530584g0020MA_688105g0010MA_219456g0010.27.188MA_100289g0010MA_10429961g0010
MA_10435462g0010MA_4654636g0010MA_207447g0010MA_10309446g0010
Populus trichocarpaPotri.016G042800.1
Prunus persicappa022480m
Ricinus communis30147.m013731.287.42730147.m013731.287.427
Thellungiella halophilaThhalv10015274m
Vitis viniferaGSVIVT01031544001.30.128GSVIVT01031543001.30.126GSVIVT01031543001.30.126GSVIVT01033543001GSVIVT01033540001
GSVIVT01031542001.43.122GSVIVT01031542001.43.122GSVIVT01031544001.30.128
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny