y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21972.1-v1.0-hybrid
FamilyCE1
Protein PropertiesLength: 315 Molecular Weight: 35113 Isoelectric Point: 7.5453
ChromosomeChromosome/Scaffold: 6 Start: 10845449 End: 10850725
DescriptionS-formylglutathione hydrolase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1513060
  STILGCSMTFHIYFPPSPSPSHKFPVLYWLSGLTCTDENFIIKSGAQRAAAKEGIALIAPDTSPRGLSIEGEAESWDFGVGAGFYLNATQEKWKNWRMYD
  YVVKELPKLLNENFPQLDTLRASISGHSMGGHGALTIYLRNLDKYKSVSAFSPIANPTNCPWGQKAFSNYLGGNKTDWEEYDATCLVKKVKDVSATILID
  QGEDDKFLNDQLLPHKFAEACSSAKVPLLLRSQPGYDHSYYFISTFIDDHISHHAQ
Full Sequence
Protein Sequence     Length: 315     Download
MPNLEGVGCV FYIRKVPAIK SSSAKMEECK PTEISSSKMF EGYNKRYKHF STILGCSMTF    60
HIYFPPSPSP SHKFPVLYWL SGLTCTDENF IIKSGAQRAA AKEGIALIAP DTSPRGLSIE    120
GEAESWDFGV GAGFYLNATQ EKWKNWRMYD YVVKELPKLL NENFPQLDTL RASISGHSMG    180
GHGALTIYLR NLDKYKSVSA FSPIANPTNC PWGQKAFSNY LGGNKTDWEE YDATCLVKKV    240
KDVSATILID QGEDDKFLND QLLPHKFAEA CSSAKVPLLL RSQPGYDHSY YFISTFIDDH    300
ISHHAQAVKL PPQP*                                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00756Esterase2.0e-5551301263+
COG0627COG06274.0e-8334312308+
TIGR02821fghA_ester_D1.0e-13134308276+
PLN02442PLN02442028310283+
Gene Ontology
GO TermDescription
GO:0004091carboxylesterase activity
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
GO:0016023cytoplasmic membrane-bounded vesicle
GO:0018738S-formylglutathione hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fcx_B0333065278A Chain A, Crystal Structure Of Human Esterase D
PDB3fcx_A0333065278A Chain A, Crystal Structure Of Human Esterase D
PDB3s8y_A0343057275A Chain A, Bromide Soaked Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_B0343057275A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_A0343057275A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00724.1Aquca_014_00724.3Aquca_014_00724.2
Arabidopsis lyrata903473
Arabidopsis thalianaAT2G41530.1
Brachypodium distachyonBradi2g60400.1
Brassica rapaBra000230Bra004627
Carica papayaevm.model.supercontig_182.15
Capsella rubellaCarubv10023793m
Chlamydomonas reinhardtiiCre03.g158800.t3.1Cre03.g158800.t1.3Cre03.g158800.t2.1
Citrus clementinaCiclev10005572m
Citrus sinensisorange1.1g023324morange1.1g024077m
Eucalyptus grandisEucgr.K02019.2Eucgr.K01713.1Eucgr.K02019.1
Glycine maxGlyma10g15910.1Glyma02g33350.1
Gossypium raimondiiGorai.002G227600.1Gorai.002G227600.2Gorai.002G227600.3
Linum usitatissimumLus10031051Lus10035437Lus10042038
Malus domesticaMDP0000130742MDP0000878750
Manihot esculentacassava4.1_014031mcassava4.1_013351m
Mimulus guttatusmgv1a011293m
Oryza sativaLOC_Os01g71300.2LOC_Os01g71300.1
Panicum virgatumPavirv00039463mPavirv00031885m
Physcomitrella patensPp1s61_17V6.4Pp1s61_17V6.5Pp1s61_17V6.3Pp1s61_17V6.2Pp1s61_17V6.1
Phaseolus vulgarisPhvul.007G250500.1
Picea abiesMA_348109g0010
Populus trichocarpaPotri.006G047000.5Potri.006G047000.1Potri.006G047000.2Potri.006G047000.3Potri.006G047000.4
Prunus persicappa009542m
Ricinus communis29840.m000625
Setaria italicaSi001977mSi023477m
Selaginella moellendorffii151094
Sorghum bicolorSb03g045400.1
Thellungiella halophilaThhalv10017045m
Vitis viniferaGSVIVT01033232001
Volvox carteriVocar20000681m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny