y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna21990.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 474 Molecular Weight: 53091.5 Isoelectric Point: 6.7657
ChromosomeChromosome/Scaffold: 6 Start: 10971480 End: 10972901
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12624523e-33
  ACLEWLDEQEPNSVIYVSFGTTTCMKDEQIRELAIGLEQCNHKFIWVLRDADKGDLFMDGDQVRKAELPKGYEERVKERGVVVRDWAPQLDILSHKSTAW
  FLSHCGWNSCMESLTLGVPIACWPMHSDQPRNTVLVTKVLKVGVVMRDWERRNELVTSSIVTDGVHKLMASSGEVDVIRKKARELGAAVRG
Full Sequence
Protein Sequence     Length: 474     Download
MAYNHQNNNH DEVVVVMVPL PAQGHLNQLL HLSRLISTYN MPVHFVGTPN HNRQAKLRVH    60
GWDQTSSDAK NTIHFHDFIV PPFVCPAPNP DAPSKFPSHL LPTFEATTHL RHPVAALLRK    120
LASQTRRVVV IHDSLMASVI QDVGSIANSE SYTFHSVSAF AVFLYLWEGI GCPPELQGVQ    180
VKSKIPDNVP SLEDCFPDEF MNFIVAQYEY TGYNSGNIYN ASRTIEGEYV DLLNKLGDDK    240
KHWAVGPFNP VSVPEKNGKR HACLEWLDEQ EPNSVIYVSF GTTTCMKDEQ IRELAIGLEQ    300
CNHKFIWVLR DADKGDLFMD GDQVRKAELP KGYEERVKER GVVVRDWAPQ LDILSHKSTA    360
WFLSHCGWNS CMESLTLGVP IACWPMHSDQ PRNTVLVTKV LKVGVVMRDW ERRNELVTSS    420
IVTDGVHKLM ASSGEVDVIR KKARELGAAV RGSMVEGGGS HMELSSFVAH ITR*          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028636.0e-384473507+
PLN02555PLN025552.0e-3815473490+
PLN02534PLN025342.0e-3816473509+
PLN03007PLN030072.0e-449472497+
PLN00164PLN001641.0e-44243473233+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A2e-391547111477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A3e-38154659461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A3e-38154659461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A3e-38154659461A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbj_A1e-37245472245453A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)