y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna22044.1-v1.0-hybrid
FamilyGT29
Protein PropertiesLength: 614 Molecular Weight: 69924.4 Isoelectric Point: 8.8373
ChromosomeChromosome/Scaffold: Start: 3979229 End: 3983051
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT292034090
  EQRRYESCAVVGNSGILLKSNHGALIDSHEVVIRLNNARIASFEDKVGSKTNISFVNSNILHLCARRNGCFCHPYGQNVPIIMYICQPVHFFDYTICNVS
  HKAPLLVTDLRFDVLTARIVKYYSLKRFGEETGKSFDEWGAAHDAAMFHYSSGMQAIMLALGICDKVSVFGFGKSESAKHHYHTNQKAELRLHDYEAEYA
  FYHDLVE
Full Sequence
Protein Sequence     Length: 614     Download
MTKSTVTQNG SNPQSFKICR LYFWPHLATP TNPLNDFFIL PMKLSVRPLF SLLLLIVFAA    60
TLSCRTAVRH SLSLIEFEKK ALLPPPKPVF NATLLRFAAD DVGGAQAKKE VEQLLDGNFA    120
SLGRYRGFAS WRRFNHHDVR ARTSAGYPVM LRSPQFYRYW LEFRRLLSDW SRNRRFEPDV    180
MLDLVRLVKD PIDGRNGSVG GSEQRRYESC AVVGNSGILL KSNHGALIDS HEVVIRLNNA    240
RIASFEDKVG SKTNISFVNS NILHLCARRN GCFCHPYGQN VPIIMYICQP VHFFDYTICN    300
VSHKAPLLVT DLRFDVLTAR IVKYYSLKRF GEETGKSFDE WGAAHDAAMF HYSSGMQAIM    360
LALGICDKVS VFGFGKSESA KHHYHTNQKA ELRLHDYEAE YAFYHDLVER PQGMPSYFNH    420
MMGFLPAGLI VGIFAPFSYE APAGFLAAGW TLLWECLLYY LMILWLLHVQ EKEVDKVWDY    480
TRNSIEYMDV SATAMRRKDN MRGEERTVEL LVSVSMDGGC SNRPCYNLLR SALGCGCAHL    540
MLLHLPLSTD TSPPSLNNAT FREREGKTKP NRRRKLDCTS SFSKLDLLWA PKREIGFAKQ    600
QNHTSTEMED WHC*                                                      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_293.0e-31157409268+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000000000215738756261A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2wnb_A0.0000000000000215738756261A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000000000315738856262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
3759
416435
445467
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi5g15097.1Bradi4g42490.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.004G009500.1Gorai.009G086400.1Gorai.001G121600.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00003354mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Phaseolus vulgarisPhvul.011G093000.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny