y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna22509.1-v1.0-hybrid
FamilyPL1
Protein PropertiesLength: 209 Molecular Weight: 22716.5 Isoelectric Point: 8.6051
ChromosomeChromosome/Scaffold: 6 Start: 2322468 End: 2323094
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL131252.8026e-45
  DGDAISIFGSKHIWIDHNSLSNCDDGLVDVVQASTAVTISNNLFKHHDKVMLLGHSDAYTQDKVMQVTVAYNRFGQGLVQRLPHCRHGSFDIVNNDYPKG
  WGVYAIGGSANPAINSQGNRFYA
Full Sequence
Protein Sequence     Length: 209     Download
MADGDAISIF GSKHIWIDHN SLSNCDDGLV DVVQASTAVT ISNNLFKHHD KVMLLGHSDA    60
YTQDKVMQVT VAYNRFGQGL VQRLPHCRHG SFDIVNNDYP KGWGVYAIGG SANPAINSQG    120
NRFYADAVKH PYTNQVTKRI VGSESEWKRW NWRSSGDLFL NGAYFVPSGD ASSAAYVKAS    180
STLAKPASMV RAMTANAGVL TCRKDQVC*                                      240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-195123131+
pfam00544Pec_lyase_C5.0e-502123130+
smart00656Amb_all4.0e-522123131+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B03201149346A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A03201149346A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A6e-163123115246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A0.0000000000000025105190317A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pe9_B0.00000000000022143141307A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
Orthologous Group
SpeciesID
Eucalyptus grandisEucgr.C02253.1
Linum usitatissimumLus10042509
Medicago truncatulaAC235749_18.1Medtr3g070740.1
Picea abiesMA_6752784g0010MA_10437227g0010MA_62112g0010MA_61800g0010MA_10334081g0010
MA_5905665g0010
Vitis viniferaGSVIVT01033671001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny