y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna22540.1-v1.0-hybrid
FamilyGH2
Protein PropertiesLength: 977 Molecular Weight: 111348 Isoelectric Point: 6.8147
ChromosomeChromosome/Scaffold: 6 Start: 2525989 End: 2531079
Descriptionglycoside hydrolase family 2 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2437380
  WVEAVVPGTVLATLVKSKELPDPFYGLENESIIDIADSGRQWYTFWYFTTFQCKLLGTQHLDLNFRGINYYAEVYLNGHKKDVPRGMFRRHSLDVTDIVR
  NGENLLAVVVYPPDHPGSIPPEGGQGGDHEIGKDVATQYVEGWDWMCPIRDRNTGIWDEVSIYVTGPVKIIDPHLVSTFYDNYKRAYLHATTELENRSTS
  VAECSLNIQVTTELEGNICLVEHLQTQHLSIPAGSRVQYTFPESIMWQLFFYKPNLWWPNGMGKQSLYNVVITVDVKGYGESDLYSQLFGFRKIESHIDN
  ATGGRLFKVNGQPIFIRGGNWILSDGLLRLSEKRYKTDIKFHSDMNFNMIRCWGGGLAERPEFYYYCDIYGLLVWQEFWITGDVDGRGVPVSNPNGPLDH
  DLFMLCARDTVKLLRNHPSLALWVGGNEQVPPDDINKALKQDLRLHPHFEKSINGSGISENLKSVDPSQYLDGTRIYIKGSMWDGFANGKGDFTDGPYEI
  QNPEDFFKDDFYKYGFNPEVGSVGMPVAATIRATMPPEGWQIPLFKKASNDYEEAPNPIWEYHKYIPYSKPGKVRDQISLYGFPKDLDDFCLQAQLANYI
  QYRALLEGWTSRMWSKYTGVLIWKTQNPWTGLRGQFYDHLLDQTAGFYGCRCAAEPLHVQLNLATYFIEVVNTTSEELSDVAIEVSVWDLDGACPY
Full Sequence
Protein Sequence     Length: 977     Download
MATAIGKTKL HSGWLGTRDR DVTVTGVQLT TTHPPSLGPT SPWVEAVVPG TVLATLVKSK    60
ELPDPFYGLE NESIIDIADS GRQWYTFWYF TTFQCKLLGT QHLDLNFRGI NYYAEVYLNG    120
HKKDVPRGMF RRHSLDVTDI VRNGENLLAV VVYPPDHPGS IPPEGGQGGD HEIGKDVATQ    180
YVEGWDWMCP IRDRNTGIWD EVSIYVTGPV KIIDPHLVST FYDNYKRAYL HATTELENRS    240
TSVAECSLNI QVTTELEGNI CLVEHLQTQH LSIPAGSRVQ YTFPESIMWQ LFFYKPNLWW    300
PNGMGKQSLY NVVITVDVKG YGESDLYSQL FGFRKIESHI DNATGGRLFK VNGQPIFIRG    360
GNWILSDGLL RLSEKRYKTD IKFHSDMNFN MIRCWGGGLA ERPEFYYYCD IYGLLVWQEF    420
WITGDVDGRG VPVSNPNGPL DHDLFMLCAR DTVKLLRNHP SLALWVGGNE QVPPDDINKA    480
LKQDLRLHPH FEKSINGSGI SENLKSVDPS QYLDGTRIYI KGSMWDGFAN GKGDFTDGPY    540
EIQNPEDFFK DDFYKYGFNP EVGSVGMPVA ATIRATMPPE GWQIPLFKKA SNDYEEAPNP    600
IWEYHKYIPY SKPGKVRDQI SLYGFPKDLD DFCLQAQLAN YIQYRALLEG WTSRMWSKYT    660
GVLIWKTQNP WTGLRGQFYD HLLDQTAGFY GCRCAAEPLH VQLNLATYFI EVVNTTSEEL    720
SDVAIEVSVW DLDGACPYYK VHENLSMLPK RTVPITEMKY PKSRNPKPVY FLLLKLYHKS    780
NFRIISRNFY WLHLSGGDYK LLEPYRKKRV PLKILSEVFI KGTTYEMHMK VKNTSAKPQP    840
KTLTYQNHFT PKLGDGDFDV HSVEPKPDGA DEKHGVGFLQ NIYRHFTKET DGLRVAEING    900
SDVGVAFFLH FSVHGVKKDH KEGEDTRILP VHYTDNYFSL VPGESMPVKI TFEVPPGVTP    960
RVSLQGWNYH GAHRVR*                                                   1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10150PRK101501.0e-887470417+
PRK09525lacZ2.0e-9136470360+
pfam00703Glyco_hydro_24.0e-11210334125+
PRK10340ebgA1.0e-22105470381+
COG3250LacZ1.0e-4144690678+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B03979277767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A03979277767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzu_B03979277767A Chain A, Complex Of Amycolatopsis Orientalis Exo-Chitosanase Csxa D469a With Pnp-Beta-D-Glucosamine
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny