y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna22843.1-v1.0-hybrid
FamilyGH95
Protein PropertiesLength: 928 Molecular Weight: 102170 Isoelectric Point: 7.7651
ChromosomeChromosome/Scaffold: Start: 3034053 End: 3044306
Description1,2-alpha-L-fucosidases
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95284200
  RSEPLKVTFGGPAKFWTDAIPIGNGRLGAMVWGGVASETLQLNEDTLWTGTPGNYTNTNAPQALTEVRQLVDDGKYAEATEAAVKLTGDPSDVYQLLGNI
  NLEFDDLHLKYAEETYSRELDLDTATARIKYSVGEVKYTREHFASNPDQVIVTKISASKSGSLSFTVSLDSKLHHGSHVNGQNQIILEGSCPGKRIAPKA
  NDNPKGIQFTAVLDLQISGDKGVIHSLDDKKIRVEEADWAILLLVASSSFEDPFTKPSDSKRNPTSESLAALTSIKRISYSDLYARHLDDYQNLFHRVSL
  QLSKSSKSIFGNKTMEMKKCNNITSLNCKGNDNALGSTADRVKTFKIDEDPSFVELLFQYGRYLLISCSRPGTQPANLQGIWNYKIEPAWDRD
GH954908040
  EVNYEASGWVVHQVTDIWAKTSPDRGQADFLKNKAYPLLEGCASFLLDWLIEGRGGYLETNPSTSPEHMFIAPDGKQASVSYSSTMDISIIKEVFSAVLS
  AAEVLGKTQNTFVENVRNAQSRLPPTKIARDGSIMEWAQDFEDPEVHHRHVSHLFGLFPGHTITLGKNPNLCKAVDYTLYKRGEEGPGWSTTWKIALWAR
  LHNSEHAYRMVKHLIDLVDPEHESDFEGGLYSNLFTAHPPFQIDANFGFSAAVAEMLVQSTVKDLYLLPALPRDKWANGCVKGLKARGGVTVNICWNEGD
  LHEVGLWSKDNTTVQ
Full Sequence
Protein Sequence     Length: 928     Download
MEDGDWVLVR QPAEKDLWTP SLVKEEERSE PLKVTFGGPA KFWTDAIPIG NGRLGAMVWG    60
GVASETLQLN EDTLWTGTPG NYTNTNAPQA LTEVRQLVDD GKYAEATEAA VKLTGDPSDV    120
YQLLGNINLE FDDLHLKYAE ETYSRELDLD TATARIKYSV GEVKYTREHF ASNPDQVIVT    180
KISASKSGSL SFTVSLDSKL HHGSHVNGQN QIILEGSCPG KRIAPKANDN PKGIQFTAVL    240
DLQISGDKGV IHSLDDKKIR VEEADWAILL LVASSSFEDP FTKPSDSKRN PTSESLAALT    300
SIKRISYSDL YARHLDDYQN LFHRVSLQLS KSSKSIFGNK TMEMKKCNNI TSLNCKGNDN    360
ALGSTADRVK TFKIDEDPSF VELLFQYGRY LLISCSRPGT QPANLQGIWN YKIEPAWDRD    420
VKRTSALGLK CGPPSILHPP APATARLHPI RLHQRPRPLS LPGKVVWNAG GVFWGGGAPS    480
PVPESGERME VNYEASGWVV HQVTDIWAKT SPDRGQADFL KNKAYPLLEG CASFLLDWLI    540
EGRGGYLETN PSTSPEHMFI APDGKQASVS YSSTMDISII KEVFSAVLSA AEVLGKTQNT    600
FVENVRNAQS RLPPTKIARD GSIMEWAQDF EDPEVHHRHV SHLFGLFPGH TITLGKNPNL    660
CKAVDYTLYK RGEEGPGWST TWKIALWARL HNSEHAYRMV KHLIDLVDPE HESDFEGGLY    720
SNLFTAHPPF QIDANFGFSA AVAEMLVQST VKDLYLLPAL PRDKWANGCV KGLKARGGVT    780
VNICWNEGDL HEVGLWSKDN TTVQKLHYRG STVTANISLR GKRMALRSAG SLSRSLASAA    840
RVSLHRSAPT LRRLRPPTAP AARRFSFTSP RNLGELGCAQ SLLPMRTATC LTSHLTVNMR    900
ACCELSHGLA VPCTALFLTA SILFVSK*                                       960
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0328473792A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0328473792A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B0579718841A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A0579718841A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B0579718841A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)