y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna22851.1-v1.0-hybrid
FamilyGH95
Protein PropertiesLength: 759 Molecular Weight: 84498.9 Isoelectric Point: 5.3402
ChromosomeChromosome/Scaffold: Start: 3092993 End: 3097830
Description1,2-alpha-L-fucosidases
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95284140
  SSEPLKVTFGGPAKFWTDAIPIGNGRLGAMVWGGVASETLQLNEDTLWTGTPGNYTNPNAPQALTEVRKLVDDGKYAEATEAAVKLSGEQSAVYQLLCDI
  NLEFDDSHLKYAEETYSRELDLDTATARIKYSVGEVEYTREHFASNPDQVIVTKISASKSGSLSFTVSLDSKLHHGSHVNGLNQIILEGSCPGKRIDDGI
  QFTAVLDLQISGDKGVIHALDDMKFRVEEADWAVLLLVASSSFKNPFTEPSDSKRSPTSESLAALNSIKNLSYSDLYAHHLDDYQNLFHRVSLQLSKSCK
  SIYENKSLEMKKYYPIKNLNFKGSDNALGSTADRVNSFKTDEDPSLVELLFQYGRYLLISCSRPGTQPANLQGIWNDKTSPPWEVNY
GH954127310
  VNYEASGWVVHQVTDVWAKTSPDRGEADFLKSKAYPLLEGCASFLLDWLIEGPGEYLETNPSTSPEHMFIAPDGKQASVSYSTTMDISIIKEVFSAVLSA
  AEVLGKTQDTFIEHVRNAQSRLPPTKIARDGSIMEWAQDFEDPDVHHRHVSHLFGLFPGHTITLEKNPDLCKAVDYTLYKRGEEGPGWSTTWKTALWARL
  HNSEHAYRMVKHLINLVDPERESDFEGGLYSNLFTAHPPFQIDANFGFSAAVAEMLVQSTVEDLYLLPALPRDKWANGCIKGLKARGRVTVNICWSEGDL
  HEVGIWSENNNTVKVLHYRG
Full Sequence
Protein Sequence     Length: 759     Download
MEDGDWVLVR PPAEKDLWTP SLVKEHESSE PLKVTFGGPA KFWTDAIPIG NGRLGAMVWG    60
GVASETLQLN EDTLWTGTPG NYTNPNAPQA LTEVRKLVDD GKYAEATEAA VKLSGEQSAV    120
YQLLCDINLE FDDSHLKYAE ETYSRELDLD TATARIKYSV GEVEYTREHF ASNPDQVIVT    180
KISASKSGSL SFTVSLDSKL HHGSHVNGLN QIILEGSCPG KRIDDGIQFT AVLDLQISGD    240
KGVIHALDDM KFRVEEADWA VLLLVASSSF KNPFTEPSDS KRSPTSESLA ALNSIKNLSY    300
SDLYAHHLDD YQNLFHRVSL QLSKSCKSIY ENKSLEMKKY YPIKNLNFKG SDNALGSTAD    360
RVNSFKTDED PSLVELLFQY GRYLLISCSR PGTQPANLQG IWNDKTSPPW EVNYEASGWV    420
VHQVTDVWAK TSPDRGEADF LKSKAYPLLE GCASFLLDWL IEGPGEYLET NPSTSPEHMF    480
IAPDGKQASV SYSTTMDISI IKEVFSAVLS AAEVLGKTQD TFIEHVRNAQ SRLPPTKIAR    540
DGSIMEWAQD FEDPDVHHRH VSHLFGLFPG HTITLEKNPD LCKAVDYTLY KRGEEGPGWS    600
TTWKTALWAR LHNSEHAYRM VKHLINLVDP ERESDFEGGL YSNLFTAHPP FQIDANFGFS    660
AAVAEMLVQS TVEDLYLLPA LPRDKWANGC IKGLKARGRV TVNICWSEGD LHEVGIWSEN    720
NNTVKVLHYR GSKVTANISS GRIYTFNRQL KCVRTVTL*                           780
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0327353761A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0327353761A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2ead_B1e-351747620474A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum In Complex With Substrate
PDB2ead_B3e-27441714527837A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum In Complex With Substrate
PDB2ead_A1e-351747620474A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum In Complex With Substrate
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)