y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23005.1-v1.0-hybrid
FamilyGH28
Protein PropertiesLength: 623 Molecular Weight: 68313.7 Isoelectric Point: 6.3419
ChromosomeChromosome/Scaffold: 4 Start: 21141023 End: 21146191
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281184430
  AACAVESAVVLAPADYCFKITSTIFSGPCKPGLVFQVDGILMTPDGPKAWPKVDSNKQWLVFYRLDQMTFTGSGTIEGNGQKWWDLPCKPHRGPNGSTAS
  GPCDSPALIRFFMSSNLVVKGLRIQNSPMFHMKFDGCEGVHIERLSISSPKLSPNTDGIHIENTKSVGIYDSMISNGDDCISIGPGCANVDIMGVTCGPS
  HGISIGSLGVHNSQACVSNITVRNVVIRESDNGLRIKTWQGGTGCVSGILFENINMENVMNCLLVDQYYCTSKGCLNQTSAVYVTDLTYRMIKGTYDVRK
  PPIHFACSDTVACTNITLSEVELYPY
Full Sequence
Protein Sequence     Length: 623     Download
MEHRTVIILW ISIILVLIQN PSNVQGRYHY HKKSSKGSQS PTPSPESPQS PEPVAPPSTP    60
VAPSTPVVPS TPSIPPNVPS DPYPGDDPTD CIFNVMSYGA VGDGDADDTK AFRDAWKAAC    120
AVESAVVLAP ADYCFKITST IFSGPCKPGL VFQVDGILMT PDGPKAWPKV DSNKQWLVFY    180
RLDQMTFTGS GTIEGNGQKW WDLPCKPHRG PNGSTASGPC DSPALIRFFM SSNLVVKGLR    240
IQNSPMFHMK FDGCEGVHIE RLSISSPKLS PNTDGIHIEN TKSVGIYDSM ISNGDDCISI    300
GPGCANVDIM GVTCGPSHGI SIGSLGVHNS QACVSNITVR NVVIRESDNG LRIKTWQGGT    360
GCVSGILFEN INMENVMNCL LVDQYYCTSK GCLNQTSAVY VTDLTYRMIK GTYDVRKPPI    420
HFACSDTVAC TNITLSEVEL YPYEGELMDD PFCWNAYGTQ ETPTIPPIEC LQDGQPEALA    480
EVAHHLRGRD RNPPSGVASR DDEMETEEIP KSPLRLPPPP TPIRFGKQLK ENMPSLQTAL    540
PPELANNVIR LYRECIRRAK YVGHRQHNTQ LVVDMVRQQF KKNMNETDPD KIQQCKDDAA    600
RGLINHILFE SEKMSGRKFS KT*                                            660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03010PLN030102.0e-7292446360+
PLN02188PLN021883.0e-7786467386+
PLN02218PLN022183.0e-8794440351+
pfam00295Glyco_hydro_281.0e-88140440302+
PLN02793PLN027936.0e-11392475387+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nhc_F2e-2315444040318A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_E2e-2315444040318A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_D2e-2315444040318A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_C2e-2315444040318A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_B2e-2315444040318A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Signal Peptide
Cleavage Site
26
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00125.1Aquca_037_00071.1Aquca_020_00147.1Aquca_061_00050.1Aquca_242_00002.1
Aquca_020_00129.3Aquca_020_00129.2Aquca_020_00129.1Aquca_020_00130.1Aquca_020_00129.4
Aquca_025_00355.1Aquca_002_00126.1Aquca_025_00355.2Aquca_029_00086.1Aquca_003_00408.1
Aquca_003_00411.1Aquca_005_00511.1Aquca_002_00126.2Aquca_002_00126.3Aquca_014_00768.1
Aquca_020_00127.1Aquca_003_00408.2
Arabidopsis lyrata877129486197477239474834483267
484425857359326950316947872183
488306326150893483471186891621
887386327610860213857358313215
479028912805917084884179857360
Arabidopsis thalianaAT1G23460.1AT1G70500.1AT1G80170.1AT2G41850.1AT3G57510.1
AT3G26610.1AT1G80140.1AT5G27530.1AT3G07970.1AT5G17200.1
AT1G60590.1AT1G10640.1AT5G14650.1AT1G56710.1AT1G48100.1
AT4G01890.1AT1G02460.1AT4G32380.1AT3G15720.1AT4G35670.1
AT5G44840.1AT5G44830.1AT4G32375.1AT3G15720.2AT4G32370.1
AT5G39910.1
Brachypodium distachyonBradi2g33080.1Bradi2g46400.1Bradi2g18060.1Bradi1g04630.1Bradi1g04610.1
Bradi2g18050.1Bradi1g69760.1Bradi2g18040.1Bradi2g44750.2Bradi2g44750.1
Bradi2g11380.1Bradi2g12400.1Bradi2g33437.1Bradi2g14880.1Bradi3g02850.1
Bradi1g51310.1Bradi2g18030.1Bradi5g18370.1Bradi2g04550.1Bradi2g04520.1
Brassica rapaBra016912Bra016911Bra024602Bra016213Bra004655
Bra012375Bra016345Bra003555Bra007332Bra003286
Bra025216Bra018707Bra008748Bra023600Bra018429
Bra031724Bra027148Bra019912Bra027926Bra032600
Bra000911Bra033328Bra008572Bra025631Bra027211
Bra027210Bra001605Bra029690Bra001279Bra025099
Bra025103Bra011341Bra008493
Carica papayaevm.model.supercontig_69.86evm.model.supercontig_92.36evm.model.supercontig_125.9evm.model.supercontig_69.85evm.model.supercontig_108.28
evm.model.supercontig_69.66evm.model.supercontig_69.65evm.model.supercontig_733.1evm.model.supercontig_146.54evm.model.supercontig_259.7
evm.model.supercontig_125.10evm.model.supercontig_37.67evm.model.supercontig_10.230evm.model.supercontig_10.242evm.model.supercontig_10.250
evm.model.supercontig_10.252
Capsella rubellaCarubv10011268mCarubv10025174mCarubv10017263mCarubv10020232mCarubv10019065m
Carubv10003877mCarubv10018919mCarubv10003570mCarubv10022105mCarubv10006248m
Carubv10015662mCarubv10003473mCarubv10008765mCarubv10020088mCarubv10022386m
Carubv10008991mCarubv10008847mCarubv10007643mCarubv10027840mCarubv10013685m
Carubv10006920mCarubv10028151mCarubv10007828mCarubv10006733m
Citrus clementinaCiclev10033386mCiclev10027523mCiclev10024556mCiclev10033716mCiclev10027366m
Ciclev10010440mCiclev10030577mCiclev10031220mCiclev10015111mCiclev10004899m
Ciclev10004898mCiclev10005317mCiclev10026919mCiclev10027074mCiclev10027137m
Citrus sinensisorange1.1g013309morange1.1g040748morange1.1g017991morange1.1g041470morange1.1g041224m
orange1.1g047738morange1.1g037736morange1.1g046362morange1.1g009748morange1.1g040454m
orange1.1g012057morange1.1g015319morange1.1g039868m.129.335orange1.1g039868m.129.335orange1.1g043061m
orange1.1g028660m
Cucumis sativusCucsa.286160.1Cucsa.249050.1Cucsa.127930.1Cucsa.105310.3Cucsa.105310.2
Cucsa.105310.1Cucsa.286260.1Cucsa.286160.2Cucsa.286260.2Cucsa.093830.1
Cucsa.286150.1Cucsa.394250.1Cucsa.339820.1Cucsa.135180.1Cucsa.192550.1
Cucsa.128570.1Cucsa.096470.1Cucsa.286160.3Cucsa.158450.1Cucsa.132050.1
Eucalyptus grandisEucgr.J01279.1Eucgr.J00557.1Eucgr.H02555.1Eucgr.G03373.1Eucgr.J03054.1
Eucgr.H02537.1Eucgr.A02373.1Eucgr.H04092.2Eucgr.B03312.1Eucgr.B03312.2
Eucgr.I01777.1Eucgr.B01667.1Eucgr.H04092.1Eucgr.C02788.1Eucgr.C02787.1
Eucgr.C02785.1Eucgr.C01750.1Eucgr.C01172.1Eucgr.B01677.1Eucgr.H01308.1
Eucgr.F02531.1Eucgr.I01918.1Eucgr.H00895.1
Fragaria vescamrna05877.1-v1.0-hybridmrna08295.1-v1.0-hybridmrna24528.1-v1.0-hybridmrna03600.1-v1.0-hybridmrna26823.1-v1.0-hybrid
mrna08290.1-v1.0-hybridmrna00293.1-v1.0-hybridmrna31029.1-v1.0-hybridmrna00430.1-v1.0-hybridmrna05284.1-v1.0-hybrid
mrna28438.1-v1.0-hybrid.113.298mrna28438.1-v1.0-hybrid.113.298mrna25737.1-v1.0-hybridmrna17262.1-v1.0-hybridmrna17261.1-v1.0-hybrid
mrna11646.1-v1.0-hybrid.225.503mrna11646.1-v1.0-hybrid.225.503mrna11646.1-v1.0-hybrid.225.503mrna11646.1-v1.0-hybrid.544.785mrna11646.1-v1.0-hybrid.544.785
mrna11646.1-v1.0-hybrid.544.785
Glycine maxGlyma02g31540.1Glyma10g17550.1Glyma18g19586.1Glyma08g39315.1Glyma15g01250.6
Glyma15g01250.5Glyma15g01250.4Glyma15g01250.2Glyma15g01250.1Glyma19g32241.2
Glyma19g32241.1Glyma03g29420.2Glyma15g43080.2Glyma10g11480.2Glyma09g35870.2
Glyma15g01250.15Glyma15g01250.14Glyma15g01250.13Glyma15g01250.12Glyma15g01250.10
Glyma15g01250.9Glyma15g01250.8Glyma15g01250.7Glyma15g01250.3Glyma15g01250.11
Glyma03g38140.1Glyma12g01480.1Glyma19g40740.1Glyma19g41430.2Glyma05g08730.1
Glyma01g03400.1Glyma02g04230.1Glyma13g44140.2Glyma15g01166.1Glyma15g43080.3
Glyma03g23680.2Glyma07g12321.1Glyma18g19670.1Glyma08g39340.1Glyma08g39340.2
Glyma19g00230.1Glyma02g01230.1Glyma10g01290.1Glyma08g09300.3Glyma08g09300.2
Glyma15g14540.1Glyma09g03620.2Glyma05g26390.2Glyma05g26390.1Glyma05g26390.3
Glyma11g16430.3Glyma14g04850.1Glyma12g00630.1Glyma11g16430.2Glyma11g16430.1
Glyma03g23881.1Glyma03g23701.1Glyma14g24151.1Glyma01g14500.2
Gossypium raimondiiGorai.002G185500.4Gorai.002G185500.3Gorai.002G185500.2Gorai.002G185500.1Gorai.004G066400.1
Gorai.005G181300.1Gorai.010G226900.1Gorai.007G360000.1Gorai.009G336100.1Gorai.002G185500.5
Gorai.006G024400.1Gorai.006G137600.2Gorai.006G137600.1Gorai.013G209100.1Gorai.005G131300.1
Gorai.006G137600.5Gorai.005G181400.1Gorai.012G172100.1Gorai.001G263400.1Gorai.005G181400.2
Gorai.007G120000.1Gorai.005G069900.2Gorai.005G069900.1Gorai.006G266100.1Gorai.008G136700.1
Gorai.012G172100.2Gorai.006G266100.2Gorai.004G037600.1Gorai.006G023900.1Gorai.006G024200.1
Gorai.010G230300.1Gorai.001G206100.1Gorai.006G137600.4Gorai.006G137600.3Gorai.011G082400.1
Gorai.011G082200.1Gorai.011G082200.2Gorai.008G136700.2
Linum usitatissimumLus10036084Lus10042371Lus10019711Lus10029511Lus10030602
Lus10026299Lus10029121Lus10040610Lus10013025Lus10030604
Lus10030886Lus10029140Lus10009994Lus10038059Lus10037834
Lus10017109Lus10018302Lus10040604Lus10002727Lus10014826
Lus10036205Lus10016940Lus10030888Lus10029139Lus10032875
Lus10026798Lus10036035
Malus domesticaMDP0000558179MDP0000175757MDP0000278254MDP0000448747MDP0000236404
MDP0000233407MDP0000152045MDP0000201484MDP0000209148MDP0000159240
MDP0000249386MDP0000911278MDP0000168416MDP0000147902MDP0000205197
MDP0000326734MDP0000209147MDP0000943790MDP0000247672MDP0000135108
MDP0000128761MDP0000201485MDP0000229391MDP0000296416MDP0000470297
MDP0000127265MDP0000240113MDP0000264703MDP0000161623MDP0000258005
MDP0000220329MDP0000902285MDP0000184620
Manihot esculentacassava4.1_031445mcassava4.1_006824mcassava4.1_026153mcassava4.1_007446mcassava4.1_031312m
cassava4.1_030998mcassava4.1_028947mcassava4.1_027248mcassava4.1_021446mcassava4.1_031845m
cassava4.1_030434mcassava4.1_030872mcassava4.1_028890mcassava4.1_031681mcassava4.1_005619m
cassava4.1_022910mcassava4.1_006790mcassava4.1_021247mcassava4.1_006566mcassava4.1_026469m
cassava4.1_031716mcassava4.1_030372mcassava4.1_032307m
Medicago truncatulaMedtr2g103410.1Medtr2g060350.1Medtr7g110050.1Medtr3g030540.1Medtr7g113910.1
Medtr5g033680.1Medtr3g084380.1Medtr2g103650.1Medtr5g034090.1Medtr6g005630.1
Medtr2g032710.1Medtr1g086390.1Medtr4g034020.1Medtr5g043350.1Medtr8g008700.1
Medtr8g077320.1Medtr4g084050.1Medtr3g084360.1Medtr1g012390.1Medtr1g013740.1
Medtr1g013730.1Medtr8g006500.1
Mimulus guttatusmgv1a006357mmgv1a007235mmgv1a022147mmgv1a007521mmgv1a022836m
mgv1a018728mmgv1a017703mmgv1a018832mmgv1a018762mmgv1a004469m
mgv1a005582mmgv1a021443mmgv1a025252mmgv1a021591mmgv1a019677m
mgv1a026845mmgv1a005106m.145.343mgv1a005106m.145.343mgv1a018285m
Oryza sativaLOC_Os05g46510.1LOC_Os07g10680.1LOC_Os07g10700.1LOC_Os07g10740.1LOC_Os03g59330.1
LOC_Os02g03750.1LOC_Os05g46520.1LOC_Os03g11760.1LOC_Os01g44970.1LOC_Os01g36830.1
LOC_Os01g45060.1LOC_Os06g28670.1LOC_Os05g50260.1LOC_Os01g19170.1LOC_Os05g20020.1
LOC_Os07g10730.1LOC_Os01g07790.1
Panicum virgatumPavirv00010581mPavirv00065133mPavirv00037995mPavirv00061958mPavirv00023691m
Pavirv00022563mPavirv00027329mPavirv00052008mPavirv00062373mPavirv00000296m
Pavirv00036539mPavirv00064503mPavirv00068511mPavirv00062256mPavirv00029885m
Pavirv00056401mPavirv00061957mPavirv00043148mPavirv00052352mPavirv00054995m
Pavirv00028598mPavirv00068858mPavirv00068857mPavirv00031268mPavirv00023724m
Pavirv00054407mPavirv00044311mPavirv00011290mPavirv00013243mPavirv00011100m
Pavirv00042645mPavirv00016919mPavirv00070806mPavirv00039836m
Physcomitrella patensPp1s104_31V6.1Pp1s16_66V6.1Pp1s17_289V6.1
Phaseolus vulgarisPhvul.003G061700.1Phvul.005G175800.1Phvul.001G135100.2Phvul.001G135100.1Phvul.001G215900.1
Phvul.007G211400.1Phvul.011G015100.1Phvul.002G063500.1Phvul.005G022500.1Phvul.005G177000.1
Phvul.010G037400.1Phvul.010G018000.1Phvul.010G037300.1Phvul.003G061600.1Phvul.004G011800.1
Phvul.002G189400.1Phvul.006G121300.2Phvul.006G121300.1Phvul.008G157500.1Phvul.010G037700.1
Phvul.010G037100.1Phvul.010G037900.1Phvul.010G037200.1Phvul.010G036600.1Phvul.001G266200.1
Phvul.010G038100.1Phvul.010G037800.1Phvul.010G038000.1
Picea abiesMA_133473g0010MA_127755g0010MA_925858g0010MA_17570g0010MA_21072g0010
MA_754919g0010MA_90135g0010MA_285723g0010MA_101764g0010MA_640601g0010
MA_10433901g0010MA_63122g0010
Populus trichocarpaPotri.008G211900.1Potri.009G060400.1Potri.001G463000.1Potri.011G159000.1Potri.016G054800.1
Potri.001G171900.5Potri.001G171900.1Potri.010G044000.1Potri.001G171900.3Potri.008G188300.1
Potri.006G252900.1Potri.008G189200.1Potri.010G042100.4Potri.010G042100.1Potri.001G346800.1
Potri.001G346800.2Potri.010G042100.5Potri.010G042100.6Potri.010G042100.2Potri.010G042100.3
Potri.005G005500.1Potri.002G190600.1Potri.013G005000.1Potri.014G115700.1Potri.010G152000.2
Potri.010G152000.1Potri.008G100500.1Potri.002G190600.2Potri.010G042100.7Potri.002G190600.3
Potri.012G119700.1Potri.018G028700.1Potri.006G052700.1Potri.001G171900.4Potri.001G171900.2
Potri.001G199300.1Potri.008G100500.3Potri.008G100500.2Potri.015G088600.1
Prunus persicappb008505mppa026655mppa014982mppa022427mppa024649m
ppa1027214mppa014719mppa018519mppa004002mppa018113m
ppa005391mppa021095mppa023489mppa019727mppa021427m
ppa015822mppa015678mppa021385m
Ricinus communis29761.m00041729864.m00150029631.m00101329841.m00282530128.m008960
27504.m00061329848.m00463929917.m00198329631.m00101429889.m003362
30076.m00459129841.m002840.35.35229841.m002840.35.35229617.m00013929841.m002840.467.705
29841.m002840.467.70529848.m004640
Setaria italicaSi032233mSi022189mSi016953mSi031920mSi038799m
Si039483mSi038685mSi003853mSi000958mSi021744m
Si003854mSi006382mSi001228mSi021901mSi035806m
Si004128mSi021758mSi032719mSi011984m
Selaginella moellendorffii11126654363859478908578038
3390912909405348
Sorghum bicolorSb09g027150.1Sb01g004220.1Sb04g002530.1Sb01g042735.1Sb06g025345.1
Sb09g029500.1Sb03g025260.1Sb01g004230.1Sb03g029030.1Sb03g012280.1
Sb01g004190.1Sb03g013310.1Sb09g027160.1Sb03g004360.1Sb03g013330.1.146.351
Sb03g013330.1.146.351
Thellungiella halophilaThhalv10018548mThhalv10006630mThhalv10019797mThhalv10016680mThhalv10005982m
Thhalv10023906mThhalv10004137mThhalv10013501mThhalv10013641mThhalv10023404m
Thhalv10007255mThhalv10011452mThhalv10007481mThhalv10023928mThhalv10023886m
Thhalv10027434mThhalv10020758mThhalv10020740mThhalv10019484mThhalv10001153m
Thhalv10027449mThhalv10027457mThhalv10021935mThhalv10001187mThhalv10029273m
Thhalv10028331m
Vitis viniferaGSVIVT01033364001GSVIVT01033362001GSVIVT01013772001GSVIVT01017279001GSVIVT01033360001
GSVIVT01033303001GSVIVT01031298001GSVIVT01032117001GSVIVT01008061001GSVIVT01013800001
GSVIVT01032447001GSVIVT01013771001GSVIVT01017644001GSVIVT01028189001GSVIVT01028132001
GSVIVT01017307001GSVIVT01033359001GSVIVT01032118001GSVIVT01017302001GSVIVT01017305001
GSVIVT01008062001GSVIVT01038447001GSVIVT01017304001GSVIVT01032114001
Zea maysAC210013.4_FGT017
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)