y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23038.1-v1.0-hybrid
FamilyGH35
Protein PropertiesLength: 797 Molecular Weight: 88259.9 Isoelectric Point: 6.9759
ChromosomeChromosome/Scaffold: 4 Start: 23139411 End: 23146469
Descriptionbeta-galactosidase 17
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35653890
  FWKDGQPFQIIGGDLHYFRILPEYWEDRLLRAKALGLNTIQTYVPWNLHEPRAGTLNFEGIADIVSFLKLCQKLGFAVMLRPGPYICGEWDLGGFPAWLL
  AIKPALTLRSSDPAFLQLVERWWGSLLPKIAPLLYGNGGPIIMVQIENEYGSYGSDKAYLHHLVSLARKHLGEEVILYTTDGGSRETLDKGTIRGDAVFS
  AVDFTTGDNPWPIFELQKEFNSPGKSPPLSSEFYTGWLTHWGEKNAQTDADFTAASLKRILERNGSAVLYMAHGGTNFGFYNGANTGSDESDYKADLTSY
  DYDAPIRESGDVSNVKFKALRKAIE
Full Sequence
Protein Sequence     Length: 797     Download
MARKRTTRLT LFLFLLLSLV TFGVFVPVFA LLPSLSQSQN DQQHHPTTKS NPDIVRKFEI    60
SEDRFWKDGQ PFQIIGGDLH YFRILPEYWE DRLLRAKALG LNTIQTYVPW NLHEPRAGTL    120
NFEGIADIVS FLKLCQKLGF AVMLRPGPYI CGEWDLGGFP AWLLAIKPAL TLRSSDPAFL    180
QLVERWWGSL LPKIAPLLYG NGGPIIMVQI ENEYGSYGSD KAYLHHLVSL ARKHLGEEVI    240
LYTTDGGSRE TLDKGTIRGD AVFSAVDFTT GDNPWPIFEL QKEFNSPGKS PPLSSEFYTG    300
WLTHWGEKNA QTDADFTAAS LKRILERNGS AVLYMAHGGT NFGFYNGANT GSDESDYKAD    360
LTSYDYDAPI RESGDVSNVK FKALRKAIEQ YSSESLPPVP SDIEKKGYGS IHVSKTGNLF    420
DMIHDFDVVE SEIPITMESV GQMSGFLLYV SEYNATEYDG GNIISIPKVH DRAQVFISCP    480
SQDGHGKPTY VGTFERWVNQ PVTLPNTKCP SKISLYVLVE NMGRLNYGPY IFDMKGILSS    540
VYLDGRVLRG WKMYLLPLTN LNENPKVNPI IQATESGFIT MSTRKKLKPK SAKARIEPAF    600
YAGKFSISKQ DKIKDTFVSL SGWGKGIVTI NNFNIGRYWP LKGPQCNLYV PAPILKHGEN    660
IVVIFELQAP NPELVVHLVD QPDFTCGPTY NSNVANLLPC PNKHRGEANT MLQKLQVTST    720
STHFEGCLES SFDSCFDDKA ALAAADMAAA ATPTLAPPAA FIAVATFANA AIPPTSIALK    780
ATVGFIAIFY ATCSFR*                                                   840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_427.0e-987215146+
COG1874LacA1.0e-4268666653+
PLN03059PLN030595.0e-4568389335+
pfam01301Glyco_hydro_351.0e-15765391327+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D0566917628A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3thd_C0566917628A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3thd_B0566917628A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3thd_A0566917628A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3thc_D0566917628A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
931
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1Eucgr.J02852.1
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny