y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23054.1-v1.0-hybrid
FamilyAA3
Protein PropertiesLength: 595 Molecular Weight: 64803.1 Isoelectric Point: 9.3687
ChromosomeChromosome/Scaffold: 4 Start: 23277471 End: 23281658
DescriptionGlucose-methanol-choline (GMC) oxidoreductase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA3555850
  SSSGHINDYDYIIVGGGTAGCPLAATLSQNFSVLVLERGGVPFANSNVSFLQNFHIALEDISPKSPSQPFVSSDGVISSRARVLGGGSVINAGFYTRASP
  RFIKRVGWDAKLVNESYPWIEKQIVHEPQHEPYQIAFRDSLLAAGVAPFNGFTYDHLYGTKVGGTIFDRFGRRHSSAELLSSGNPQKLTVLIYATVQKIV
  FDTSGKTPKAVGVTFKDENGNQHQAFLADKPQSEVLLSSGAIGSPQMLLLSGIGPKADLEKLNIPVVLNNEFVGKGMADNPMNAIFVPSSREEKQTLIQI
  VGITKMGVYIEASSGFSQSKDSIECNHGIMSAEIGQLSTLPPKQRTPEAIQAFIKRKRDLPHEAFKGGFILQKIANPISKGDLRLHNTNVDDNPDVSFNY
  FSHPYDLKRCVDGIRIATKVAQSEHFTNYTRVDKQTVEKILNLSVKANVNLIPKNINDTKSLEQFCKDTVITIWHYHGGCHVGTVVSPDNKVLGVDRVRV
  VDGSTFSESPGTNPQATVLMMGRYMGLKILR
Full Sequence
Protein Sequence     Length: 595     Download
MALVNGALVL KKLIFFVALC LISVLSSSQG KEVYDEFRYP FIKKASSFAS VSSSSSSGHI    60
NDYDYIIVGG GTAGCPLAAT LSQNFSVLVL ERGGVPFANS NVSFLQNFHI ALEDISPKSP    120
SQPFVSSDGV ISSRARVLGG GSVINAGFYT RASPRFIKRV GWDAKLVNES YPWIEKQIVH    180
EPQHEPYQIA FRDSLLAAGV APFNGFTYDH LYGTKVGGTI FDRFGRRHSS AELLSSGNPQ    240
KLTVLIYATV QKIVFDTSGK TPKAVGVTFK DENGNQHQAF LADKPQSEVL LSSGAIGSPQ    300
MLLLSGIGPK ADLEKLNIPV VLNNEFVGKG MADNPMNAIF VPSSREEKQT LIQIVGITKM    360
GVYIEASSGF SQSKDSIECN HGIMSAEIGQ LSTLPPKQRT PEAIQAFIKR KRDLPHEAFK    420
GGFILQKIAN PISKGDLRLH NTNVDDNPDV SFNYFSHPYD LKRCVDGIRI ATKVAQSEHF    480
TNYTRVDKQT VEKILNLSVK ANVNLIPKNI NDTKSLEQFC KDTVITIWHY HGGCHVGTVV    540
SPDNKVLGVD RVRVVDGSTF SESPGTNPQA TVLMMGRYMG LKILRDRLGR AAGI*         600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01810betA8.0e-2364334308+
TIGR03970Rv06972.0e-2464335314+
COG2303BetA1.0e-4361592586+
PLN02785PLN02785010594586+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gdp_B06358727517A Chain A, The Structure Of The Type Iii Effector Avrb Complexed With A High-Affinity Rin4 Peptide
PDB3gdp_A06358727517A Chain A, The Structure Of The Type Iii Effector Avrb Complexed With A High-Affinity Rin4 Peptide
PDB3gdn_B06358727517A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB3gdn_A06358727517A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB1ju2_B06358727517A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond
Signal Peptide
Cleavage Site
30
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00460.1Aquca_013_00454.2Aquca_013_00454.1Aquca_013_00454.3Aquca_013_00454.5
Aquca_025_00060.1Aquca_013_00454.4Aquca_015_00360.2Aquca_015_00360.1Aquca_002_00625.1
Aquca_002_00624.1Aquca_013_00454.7Aquca_013_00454.6
Arabidopsis lyrata879508907040495263895153885302
476435918231334713920642
Arabidopsis thalianaAT1G12570.1AT3G56060.1AT1G72970.1AT5G51950.1AT5G51950.2
AT1G73050.1AT1G72970.2AT5G51930.1AT1G14190.1AT1G14185.1
Brachypodium distachyonBradi3g51670.1Bradi4g28870.1Bradi3g35310.2Bradi4g28870.2Bradi3g35310.1
Bradi3g31630.1Bradi5g18890.1Bradi1g77300.1Bradi1g31250.1
Brassica rapaBra016766Bra022571Bra008061Bra003862Bra029151
Bra028286Bra022570Bra016021Bra007212Bra007213
Bra029152Bra026850Bra008069
Carica papayaevm.model.supercontig_4.214evm.model.supercontig_131.52evm.model.supercontig_128.38evm.model.supercontig_128.39evm.model.supercontig_375.4
Capsella rubellaCarubv10008714mCarubv10019598mCarubv10028412mCarubv10016915mCarubv10020028m
Carubv10020023mCarubv10027769mCarubv10018458mCarubv10020012mCarubv10028260m
Carubv10008703m
Chlamydomonas reinhardtiiCre12.g514200.t1.2
Citrus clementinaCiclev10019611mCiclev10019456mCiclev10019427mCiclev10019445mCiclev10006541m
Ciclev10025184mCiclev10025302mCiclev10031199mCiclev10031316m
Citrus sinensisorange1.1g009272morange1.1g009241morange1.1g008331morange1.1g008675morange1.1g008281m
orange1.1g008163morange1.1g007210morange1.1g008715morange1.1g011442morange1.1g009873m
orange1.1g012707morange1.1g015588morange1.1g045695morange1.1g016822morange1.1g023276m
Cucumis sativusCucsa.341190.1Cucsa.360570.1Cucsa.359700.1Cucsa.089560.1Cucsa.089580.1
Cucsa.089600.1Cucsa.089550.1Cucsa.089500.1Cucsa.089610.1Cucsa.089510.1
Cucsa.302690.1Cucsa.089540.1Cucsa.089570.2Cucsa.068910.1Cucsa.089570.1
Cucsa.089590.1
Eucalyptus grandisEucgr.E00525.1Eucgr.A02842.1Eucgr.F03132.1Eucgr.J03148.1Eucgr.G02495.1
Fragaria vescamrna32372.1-v1.0-hybridmrna13343.1-v1.0-hybridmrna05701.1-v1.0-hybridmrna27390.1-v1.0-hybrid
Glycine maxGlyma17g14130.1Glyma05g03580.1Glyma20g29370.1Glyma07g01220.2Glyma08g20600.2
Glyma11g02930.1Glyma13g42630.1Glyma15g02790.1Glyma0615s00250.1Glyma07g00530.1
Glyma02g12060.2Glyma01g05890.2Glyma10g38480.2Glyma0615s00200.2
Gossypium raimondiiGorai.004G207200.2Gorai.004G207200.1Gorai.004G207200.4Gorai.004G207200.3Gorai.008G243300.1
Gorai.007G009900.1Gorai.009G142000.1Gorai.011G064300.1Gorai.011G199100.1Gorai.011G064300.2
Gorai.008G281500.1Gorai.009G117900.1Gorai.005G141700.1Gorai.009G142000.2Gorai.011G064300.3
Gorai.009G142000.3Gorai.009G142000.5Gorai.009G142000.4Gorai.004G207200.6Gorai.004G207200.5
Gorai.004G207200.7Gorai.004G207200.8Gorai.004G207200.10Gorai.011G064300.4
Linum usitatissimumLus10015623Lus10017827Lus10003176Lus10037640Lus10024487
Lus10002957Lus10027406Lus10031663Lus10015012Lus10038891
Lus10030459Lus10026607Lus10032641Lus10030457Lus10030456
Lus10030461Lus10033390Lus10030460Lus10012816Lus10034845
Lus10026606Lus10012817Lus10030462Lus10030458Lus10012818
Lus10030463Lus10003833Lus10024728Lus10032347
Malus domesticaMDP0000451172MDP0000185338MDP0000158474MDP0000425135MDP0000318256
MDP0000248951MDP0000903805MDP0000136847MDP0000137211MDP0000257243
MDP0000561228MDP0000130099MDP0000232295MDP0000177641MDP0000465595
MDP0000251783MDP0000288439.474.954MDP0000288439.474.954MDP0000184832MDP0000272655
MDP0000288439.45.461MDP0000288439.45.461MDP0000727481MDP0000748068MDP0000210966
MDP0000269370MDP0000151331MDP0000256300MDP0000192359MDP0000214280
MDP0000124051
Manihot esculentacassava4.1_004445mcassava4.1_004024mcassava4.1_029597mcassava4.1_003829mcassava4.1_031834m
cassava4.1_024092m
Medicago truncatulaMedtr5g011010.1Medtr5g011020.1Medtr2g100070.1Medtr1g101770.1Medtr4g005860.1
Medtr5g041340.1Medtr1g101760.1
Mimulus guttatusmgv1a003421mmgv1a003962mmgv1a025723mmgv1a003898mmgv1a025036m
mgv1a007376m
Oryza sativaLOC_Os02g45530.1LOC_Os09g19930.1LOC_Os04g48400.1LOC_Os08g31030.1LOC_Os10g38050.1
LOC_Os03g02700.1LOC_Os06g44540.1
Panicum virgatumPavirv00022245mPavirv00037597mPavirv00009521mPavirv00060828mPavirv00034775m
Pavirv00062067mPavirv00054028mPavirv00032583mPavirv00020766mPavirv00001081m
Pavirv00019408m
Physcomitrella patensPp1s3_628V6.1Pp1s78_69V6.1Pp1s78_68V6.1Pp1s472_10V6.1Pp1s85_157V6.1
Phaseolus vulgarisPhvul.003G213000.1Phvul.010G139000.1Phvul.005G159400.1Phvul.007G066200.1Phvul.010G162900.1
Phvul.002G084200.1
Picea abiesMA_159144g0050MA_46380g0010MA_115358g0010MA_41268g0010MA_10307468g0010
MA_10434495g0020MA_10432967g0010MA_3249g0010MA_15634g0010MA_68670g0010
MA_137064g0010MA_19258g0020MA_762g0010MA_10434427g0010MA_111884g0010
MA_577764g0010MA_11792g0020MA_10433135g0010MA_269764g0010MA_101730g0010
MA_159149g0270MA_159153g0080MA_159155g0150MA_147482g0030MA_159142g0110
Populus trichocarpaPotri.001G111500.8Potri.001G111500.1Potri.001G200800.1Potri.001G111500.7Potri.003G039000.1
Potri.003G039000.2Potri.008G009600.1Potri.012G135200.1Potri.008G087400.1Potri.010G168200.2
Potri.010G168200.1Potri.001G111500.4Potri.010G168100.2Potri.010G168100.1Potri.001G111500.6
Potri.001G111500.2Potri.001G111500.5Potri.001G111500.3Potri.010G249500.1
Prunus persicappa003422mppa016983mppa022070mppa015533mppa004308m
ppa003595mppa017360mppa022916mppa003414mppa020579m
Ricinus communis30147.m01432630190.m01111128694.m00067029813.m00150029748.m000381
Setaria italicaSi029318mSi013472mSi019398mSi011855mSi040002m
Si038995mSi008640m
Selaginella moellendorffii100345108291407760153538410833
9080911260380819132959410832
23255540476942952340596052668
81946235799427468413925402042
Sorghum bicolorSb04g031910.1Sb06g025960.1Sb07g019920.1Sb02g023010.1Sb01g031110.1
Sb01g049320.1Sb10g026110.1
Thellungiella halophilaThhalv10007216mThhalv10018308mThhalv10013065mThhalv10018360mThhalv10015625m
Thhalv10005870mThhalv10007408mThhalv10015735mThhalv10015262m
Vitis viniferaGSVIVT01010650001GSVIVT01019871001GSVIVT01016856001GSVIVT01010648001GSVIVT01013124001
Volvox carteriVocar20013934mVocar20013933m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)