y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23206.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 455 Molecular Weight: 48231 Isoelectric Point: 5.6445
ChromosomeChromosome/Scaffold: 7 Start: 14581755 End: 14591467
Descriptionmethylesterase PCR A
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82273691.09301e-43
  TVVAQDGLGDFVSIMDAVDVVPENSHNCVIRIKTGVYDEIVTVGKKKCNVVFIGDCVKTTVVIGNRSNIKGVRTFESATLVIEGDGFLATGITFVNMVEP
  EAGQAVAVRISSYHTAFYRCRIADFQDTLYTQDGVQFFKDQGV
Full Sequence
Protein Sequence     Length: 455     Download
MKIKVGWVLV VALLVSVFFA PTAYAVWRNK NTEVANFASV ADDHDGNDEE DGCTGSVCNI    60
VQFPCHEGCV CVPIGMLPIG ICAGTCCGTP SPSPSPTPPS PPEPPSPAPK PPTPPHPSPP    120
APPKPPTPPH PSPPTPPKPP TPPHPSPPAP PKPPTPPHPS PPAPPKPPNP PHPSPPTPPH    180
PSPPAPPHPS PPTPPHPSPP APPKPPSPCP TPPPHPSDAS ALSSEATVVA QDGLGDFVSI    240
MDAVDVVPEN SHNCVIRIKT GVYDEIVTVG KKKCNVVFIG DCVKTTVVIG NRSNIKGVRT    300
FESATLVIEG DGFLATGITF VNMVEPEAGQ AVAVRISSYH TAFYRCRIAD FQDTLYTQDG    360
VQFFKDQGVS RETVVEILYH VVIMESFLDT FIDPIGWLDW DNRLSLDIIE YVEYANRGPS    420
ADTSGKVTWR GLEVLHDSIE VLHDSIVAAQ LMAR*                               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01095Pectinesterase3.0e-1638144262+
PLN02201PLN022013.0e-37228370144+
PLN02416PLN024168.0e-42224437284+
PLN02745PLN027452.0e-42218435288+
pfam01095Pectinesterase1.0e-50228366140+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A5e-2922836410147A Chain A, Pectin Methylesterase From Carrot
PDB1gq8_A0.00000000002380440232292A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A4e-252284376285B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
25
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna23297.1-v1.0-hybrid
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny