y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23297.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 283 Molecular Weight: 31498.6 Isoelectric Point: 4.7154
ChromosomeChromosome/Scaffold: 7 Start: 14344639 End: 14347588
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8311740
  VVAQDGLGDFASIMDAVDTLPEDSPDRFIIRIKAGVYDEIVTVGKKKLNVVFIGDGVDSTVVTGNRSNVGGVRTFESATLVIEGDGFLATGITFENRAGP
  KAEQAVAVRINSYRTAFYRCRIASFQDTLYTQDGVQFFRECEIY
Full Sequence
Protein Sequence     Length: 283     Download
MGREVPAKTG NLTRLGDKEL REIVEGIYFR VVAQDGLGDF ASIMDAVDTL PEDSPDRFII    60
RIKAGVYDEI VTVGKKKLNV VFIGDGVDST VVTGNRSNVG GVRTFESATL VIEGDGFLAT    120
GITFENRAGP KAEQAVAVRI NSYRTAFYRC RIASFQDTLY TQDGVQFFRE CEIYDPVGWL    180
DWDNRSALDT IEYVEYANRG PGADMSKRVT WSGFEVLHDS ISAAQFTVWQ FIDGASWIPS    240
TGIPNDLDFR RVTLTSMGVR LTSRDWLSIV FLHVMFFTCV LH*                      300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02416PLN024161.0e-1717224675+
pfam01095Pectinesterase3.0e-2017523460+
PLN02201PLN022012.0e-4914173160+
PLN02416PLN024163.0e-5031180150+
pfam01095Pectinesterase1.0e-6631174144+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A3.00004e-413121310189A Chain A, Pectin Methylesterase From Carrot
PDB1gq8_A0.000000000000002172247242317A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A3e-34312136185B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1xg2_A6e-16173243239309B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A0.000000012817331197A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna23206.1-v1.0-hybrid
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny