y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23425.1-v1.0-hybrid
FamilyGH13
Protein PropertiesLength: 950 Molecular Weight: 105009 Isoelectric Point: 5.9695
ChromosomeChromosome/Scaffold: 7 Start: 13640874 End: 13650745
Descriptionlimit dextrinase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133577542.9e-26
  DSAGVSHLKKLSKAGMTHVHLLPAFQFSGVDDEKENWKSIAAELLVASCVYDIWPDSKILEKFPSDSSEQQALITAIQNDDGYNWGYNPVLWGVPKGSYA
  SNANGSYRAREFRKMVQALNRLGLRVVLDVVYNHLHGSGPFDANSVLDKVMIVPGYYLRRNTDGFIENSTCVNNTASEHFMVERLILDDLLHWAVDYKVD
  GFRFDLMGHMMKRTMVKAKDALCSLTKDRDGVDGSSIYIYGEGWDFGEVANNGRGVNASQFNICGTGIGSFNDRIRDAILGGSPFGHPLQQGFVTGLLLQ
  PNGYDHGPEAVAERMLAEAKDHIQVGMAANLRDFVLTNCEGKEVKGSEVLTYGGTSVAYALDPTETVNYASAHDNETLFDIVSLKGIPFFHCGDEILR
Full Sequence
Protein Sequence     Length: 950     Download
MGIYTCSLLL PPPTVNSHFP NHIRHAFSSS SIRCRFTSHP KPKPIFSFPP TSANFSRLQC    60
SASLPMSAQQ DSASTSPSQV EGSLLKSRAF WVSESIIAWN VDTGDDSCYL FASKTAALSL    120
TGDGVSGEDV KVELREDRHG LPQNVKEKFP HIKDYRAFNV PSDLDVKSLL KAQLAVATFS    180
CDGRCSDATG LQLPGILDEL FSYEGPLGAV FSKEAVSLYL WAPTSQEPLG GNPLEIVQLE    240
EVNGVWSTRG PKSWEGCYYV YEVSVYHPST LQIEKCYAND PYARGRLSSD GRRTLFINLD    300
SDSIKPDGWD KLVDEKPDIL SSSDISIYEL HIRDFSANDQ TVLPEFRGGY LAFTSQDSAG    360
VSHLKKLSKA GMTHVHLLPA FQFSGVDDEK ENWKSIAAEL LVASCVYDIW PDSKILEKFP    420
SDSSEQQALI TAIQNDDGYN WGYNPVLWGV PKGSYASNAN GSYRAREFRK MVQALNRLGL    480
RVVLDVVYNH LHGSGPFDAN SVLDKVMIVP GYYLRRNTDG FIENSTCVNN TASEHFMVER    540
LILDDLLHWA VDYKVDGFRF DLMGHMMKRT MVKAKDALCS LTKDRDGVDG SSIYIYGEGW    600
DFGEVANNGR GVNASQFNIC GTGIGSFNDR IRDAILGGSP FGHPLQQGFV TGLLLQPNGY    660
DHGPEAVAER MLAEAKDHIQ VGMAANLRDF VLTNCEGKEV KGSEVLTYGG TSVAYALDPT    720
ETVNYASAHD NETLFDIVSL KGIPFFHCGD EILRSKSLDR DSYNSGDWFN RIDFTYNSNN    780
WGVGLPPKEK NEKSWPLMKP RLAEPSFKPQ KSHIHAAVEN FSDLLHIRYS SPLFRLRTAN    840
AIQERLRFHN TGPSSVPGLI LMSIEDGHEG LPGLSQLDPI YSYIVVIVNA RPTEVSFTSS    900
SIRGRALQLH PVQVKSNDEI VKKSTYDTGS ACFTVPARTT SVFVEPRGV*               960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11852DUF33724.0e-80775947173+
TIGR02104pulA_typeI8.0e-118198898749+
cd11341AmyAc_Pullulanase_LD-like2.0e-153324780491+
PLN02877PLN0287709947982+
TIGR02103pullul_strch084947917+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4aio_A0879476883A Chain A, Endopolygalacturonase From The Phytopathogenic Fungus Fusarium Moniliforme
PDB2y5e_A0879476883A Chain A, Endopolygalacturonase From The Phytopathogenic Fungus Fusarium Moniliforme
PDB2y4s_A0879476883A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhf_A0899481791071A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhc_A0899481791071A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00024.1
Arabidopsis lyrata487216
Arabidopsis thalianaAT5G04360.1
Brachypodium distachyonBradi5g00540.2Bradi5g00540.1
Brassica rapaBra009461
Carica papayaevm.model.supercontig_53.158
Capsella rubellaCarubv10000153m
Chlamydomonas reinhardtiiCre11.g476650.t1.3
Citrus clementinaCiclev10031035m
Citrus sinensisorange1.1g002079morange1.1g002161morange1.1g002787m
Cucumis sativusCucsa.308730.1
Eucalyptus grandisEucgr.G02746.1Eucgr.G02746.2
Glycine maxGlyma10g34080.1
Gossypium raimondiiGorai.009G305300.12Gorai.009G305300.11Gorai.009G305300.1Gorai.009G305300.10Gorai.009G305300.2
Gorai.009G305300.3Gorai.009G305300.4Gorai.009G305300.5Gorai.009G305300.6Gorai.009G305300.7
Gorai.009G305300.9Gorai.009G305300.8
Linum usitatissimumLus10038675
Malus domesticaMDP0000142103
Manihot esculentacassava4.1_004771m
Mimulus guttatusmgv1a001246m
Physcomitrella patensPp1s142_79V6.1.481.888
Phaseolus vulgarisPhvul.007G139400.1
Populus trichocarpaPotri.010G229300.4Potri.010G229300.1Potri.010G229300.2Potri.010G229300.3
Prunus persicappa000905m
Ricinus communis29475.m000230
Setaria italicaSi011852m
Selaginella moellendorffii165275
Sorghum bicolorSb06g001540.1
Thellungiella halophilaThhalv10012585m
Vitis viniferaGSVIVT01016183001
Volvox carteriVocar20014607m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny