y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna23760.1-v1.0-hybrid
FamilyGT50
Protein PropertiesLength: 284 Molecular Weight: 32493.8 Isoelectric Point: 9.4344
ChromosomeChromosome/Scaffold: 2 Start: 3406901 End: 3410182
Descriptionmannosyltransferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT501442601.4013e-45
  ICLMNGLIVQLVLILSFAQDLPFCCFVQTVAFVAFNKVMTAQYFVWFFCLLPLSLAWSNMKLKWKGLSCIALWVGGQLHWLWWGYMHEFKGRNVFLQLWV
  AGIIFLSANTYVLVSLI
Full Sequence
Protein Sequence     Length: 284     Download
MEFRTLVVVS AVLRVVLIVY GEWQDTHMEV RYTDIDYMVF SDAASLMASG KSPFERSTYR    60
YSPLLAFLLL PNSILHRSWG KFIFSAADLL VGLFIRTILK LRGVPENLSM ISVMAWLFNP    120
FTFTIGTRGN CEPIVCALIL WVFICLMNGL IVQLVLILSF AQDLPFCCFV QTVAFVAFNK    180
VMTAQYFVWF FCLLPLSLAW SNMKLKWKGL SCIALWVGGQ LHWLWWGYMH EFKGRNVFLQ    240
LWVAGIIFLS ANTYVLVSLI NHHRCSPVFT QLEKISKGAK KLK*                     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06728PIG-U0.000842161132+
pfam05007Mannosyl_trans7.0e-31150260111+
PLN02841PLN028414.0e-65150276127+
PLN02841PLN028418.0e-7920153134+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Transmembrane Domains
StartEnd
8299
109126
139161
181200
207229
239261
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00057.1Aquca_027_00011.1Aquca_035_00139.1Aquca_027_00005.1Aquca_083_00090.1
Aquca_027_00008.1Aquca_083_00081.1Aquca_008_00278.1
Arabidopsis lyrata910198
Arabidopsis thalianaAT5G22130.2AT5G22130.1
Brachypodium distachyonBradi4g38200.1
Brassica rapaBra020174
Carica papayaevm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.364.444evm.model.supercontig_9.382.364.444
Capsella rubellaCarubv10000947m
Chlamydomonas reinhardtiiCre14.g616200.t1.2.125.281Cre14.g616200.t1.2.125.281Cre14.g616200.t1.2.354.469Cre14.g616200.t1.2.354.469
Citrus clementinaCiclev10001079m
Citrus sinensisorange1.1g012470morange1.1g020664morange1.1g014361m.155.293orange1.1g014361m.292.401orange1.1g014361m.292.401
orange1.1g014361m.155.293orange1.1g020629m
Cucumis sativusCucsa.099160.1
Eucalyptus grandisEucgr.H00040.1
Glycine maxGlyma08g16980.1
Gossypium raimondiiGorai.001G088100.1
Linum usitatissimumLus10000321Lus10013349
Malus domesticaMDP0000259191MDP0000246795MDP0000134018
Manihot esculentacassava4.1_033019m
Medicago truncatulaMedtr8g040610.1
Mimulus guttatusmgv1a006636mmgv1a019000mmgv1a018848m
Oryza sativaLOC_Os03g46750.1
Panicum virgatumPavirv00041326mPavirv00060844m
Physcomitrella patensPp1s171_137V6.1
Phaseolus vulgarisPhvul.005G043300.1
Picea abiesMA_10434160g0010
Populus trichocarpaPotri.001G031500.1Potri.001G031500.2
Prunus persicappa005934m
Ricinus communis30040.m000266
Setaria italicaSi029845m
Selaginella moellendorffii90874
Sorghum bicolorSb02g011300.1
Thellungiella halophilaThhalv10015361mThhalv10013575m
Vitis viniferaGSVIVT01017167001
Volvox carteriVocar20014433m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny