y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24083.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 1063 Molecular Weight: 116798 Isoelectric Point: 5.8706
ChromosomeChromosome/Scaffold: 6 Start: 35754571 End: 35763006
Descriptionpeptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2403110
  LSKIVQDGVRSAIANDSRIAASLLRLHFHDCFVSGCDASILLDDTSTLKGEKNALPNKDSARGYEVIDKIKLALEEACPCTVSCTDILTLAATSAVYFSG
  GPYWPVALGRRDGLTASIDAANNDLPSPFEPLENITAKFAAKGLDLQDVVVLSGAHTIGFAQCFTFKTRLFNFGDSGKPDPVLDTSTLTKLQRVCPNQAD
  SDTKLAPLDSVTSTKFDNFYFKRLVNKSGLLQSDQLLMGDNRTASMVISYSRFANLFNKDFGASMVKMANIG
AA23406110
  LTKIVQQGVWSAIANDSRIAASLLRLHFHDCFVNGCDASVLLDDTSTLQGEKNAFPNKDSARGFEVIDKIKSNLEEACPSTVSCTDILTLAATSAVYFSG
  GPYWPVALGRRDGTTASKDAANNDLPSPFEPLENITAKFTAKGLDMKDVVVLSGAHTIGFAQCFTFKPRLFNFDDSGKPDPTLDTSLLTNLQSVCPNQAD
  SDTKLAPLDPVTSTKFDNVYFKRLVNNSGLLQSDQVLMGDNRTASMVISYSRFPYLFNKDFGASMVKMANIG
Full Sequence
Protein Sequence     Length: 1063     Download
MDHITYKLSY VALLCLLFLS PPFVSSELSY KFYDSSCPNL SKIVQDGVRS AIANDSRIAA    60
SLLRLHFHDC FVSGCDASIL LDDTSTLKGE KNALPNKDSA RGYEVIDKIK LALEEACPCT    120
VSCTDILTLA ATSAVYFSGG PYWPVALGRR DGLTASIDAA NNDLPSPFEP LENITAKFAA    180
KGLDLQDVVV LSGAHTIGFA QCFTFKTRLF NFGDSGKPDP VLDTSTLTKL QRVCPNQADS    240
DTKLAPLDSV TSTKFDNFYF KRLVNKSGLL QSDQLLMGDN RTASMVISYS RFANLFNKDF    300
GASMVKMANI GVLTGQNGQI RRNCRVQLNY KFYDSSCPNL TKIVQQGVWS AIANDSRIAA    360
SLLRLHFHDC FVNGCDASVL LDDTSTLQGE KNAFPNKDSA RGFEVIDKIK SNLEEACPST    420
VSCTDILTLA ATSAVYFSGG PYWPVALGRR DGTTASKDAA NNDLPSPFEP LENITAKFTA    480
KGLDMKDVVV LSGAHTIGFA QCFTFKPRLF NFDDSGKPDP TLDTSLLTNL QSVCPNQADS    540
DTKLAPLDPV TSTKFDNVYF KRLVNNSGLL QSDQVLMGDN RTASMVISYS RFPYLFNKDF    600
GASMVKMANI GVLTGQSGQI RKNCRVALNQ QKTFAETVSA LLWFPSTPGP KPDPTPPPLP    660
PVSHSAHLSQ PESDIRHAPP ETRPDQTRVR VSLQPRCYLD ISIGGELEGR IVIELYNDVV    720
PKTAENFRAL CTGEKGISPT TGVPLHFKGV GFHRIIKGFM IQGGDISAGD GSGGESIYGA    780
KFEDENFEIK HERKGMVSMA NTGPDTNGSQ FFITTTRTPH LDGKHVVFGR VVKGLGVARS    840
IEHVIAKDDG EHVPTQEAVI AECGELAEGE DDGVCNFFKD GDVYPDWPVD LDEKHEEVSW    900
WVVAVNAIKA LGNEQFKKQD YKMALRKYRK ALRYLDVCWE LEDINEYNSS SLRQTKSQIF    960
TNSSACRLKL GDLEGALLDT DFALRDWEDN VKAMFRQGQT YMALNDIDSA VESFKKALEL    1020
EPNDGGIKKE LQVAKKKVRE LHMFLDLLSS QWLFTPNGRF EG*                      1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01926cyclophilin_ABH_like2.0e-78695864170+
PLN03030PLN030306.0e-82332624298+
PLN03030PLN030303.0e-849324325+
cd00693secretory_peroxidase7.0e-15427326300+
cd00693secretory_peroxidase3.0e-159327626300+
Gene Ontology
GO TermDescription
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0004601peroxidase activity
GO:0005515protein binding
GO:0006457protein folding
GO:0006979response to oxidative stress
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1iip_A067510391355A Chain A, Solution Structure Of Msin3a Pah1 Domain
PDB1ihg_A067510391355A Chain A, Bovine Cyclophilin 40, Monoclinic Form
PDB1qgj_B03276291300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_B0273261297A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A03276291300A Chain A, Arabidopsis Thaliana Peroxidase N
Signal Peptide
Cleavage Site
26
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00295.1Aquca_009_00126.1Aquca_007_00296.1Aquca_009_00240.1Aquca_010_00578.1
Aquca_010_00288.1Aquca_007_00480.1Aquca_022_00206.1Aquca_044_00082.1Aquca_002_01007.1
Arabidopsis lyrata480719487484910027915128891426
321537866489489772882539327109
489775323056326972485262485264
476012
Arabidopsis thalianaAT4G36430.1AT2G18150.1AT5G06720.1AT5G66390.1AT5G19890.1
AT4G16270.1AT5G06730.1AT2G18140.1AT1G44970.1AT2G38390.1
AT2G38380.1AT4G08770.1AT3G50990.1AT4G08780.1AT1G49570.1
AT5G19880.1AT3G32980.1AT3G49120.1AT3G49110.1AT2G35380.1
AT1G68850.1AT2G35380.2
Brachypodium distachyonBradi2g09660.1Bradi2g09680.1Bradi2g09690.1Bradi2g09650.1Bradi5g10070.1
Bradi2g40590.1Bradi1g68900.1Bradi1g43680.1Bradi1g27920.1Bradi1g68887.1
Bradi1g68927.1Bradi1g27910.1Bradi4g05230.1Bradi4g05190.1
Brassica rapaBra036330Bra039920Bra037176Bra009220Bra017761
Bra011683Bra011681Bra020072Bra009221Bra002271
Bra036842Bra000058Bra037877Bra017121Bra014200
Bra017120Bra002270Bra033551Bra012061Bra039816
Bra029933Bra000059Bra018006Bra018007Bra020071
Bra002269Bra004014Bra004343Bra005346Bra038345
Carica papayaevm.model.supercontig_6.180evm.model.supercontig_140.2evm.model.supercontig_119.100evm.model.supercontig_6.388evm.model.supercontig_119.99
evm.model.supercontig_119.98evm.model.supercontig_62.46evm.model.supercontig_9.35evm.model.supercontig_53.11evm.model.supercontig_1127.3
evm.model.supercontig_6.431
Capsella rubellaCarubv10015891mCarubv10005221mCarubv10016420mCarubv10027498mCarubv10011083m
Carubv10003822mCarubv10001380mCarubv10007253mCarubv10025052mCarubv10019275m
Carubv10001325mCarubv10001326mCarubv10009564mCarubv10016503mCarubv10017550m
Carubv10017534mCarubv10019421mCarubv10017532mCarubv10019462mCarubv10002844m
Carubv10025414mCarubv10020513m
Citrus clementinaCiclev10026054mCiclev10026130mCiclev10015779mCiclev10015783mCiclev10015790m
Ciclev10015793mCiclev10018160m
Citrus sinensisorange1.1g020149morange1.1g019976morange1.1g018873morange1.1g041231morange1.1g020050m
orange1.1g045752morange1.1g018847morange1.1g018796morange1.1g018871morange1.1g018764m
orange1.1g018855morange1.1g018811morange1.1g020451morange1.1g021592morange1.1g038520m
orange1.1g023510morange1.1g026183morange1.1g047796morange1.1g039981morange1.1g043984m
Cucumis sativusCucsa.201070.1Cucsa.043200.1Cucsa.153430.1Cucsa.247030.1Cucsa.313460.1
Cucsa.085290.1Cucsa.153470.1Cucsa.284220.1Cucsa.153470.2Cucsa.153430.2
Cucsa.153410.1Cucsa.153450.1Cucsa.153440.1Cucsa.129220.1Cucsa.153420.1
Cucsa.153400.1Cucsa.153390.1Cucsa.153390.2Cucsa.102290.1
Eucalyptus grandisEucgr.A02458.1Eucgr.H04063.1Eucgr.A02457.1Eucgr.A02459.1Eucgr.A02460.1
Eucgr.I01176.1Eucgr.D02157.1Eucgr.G02397.1Eucgr.B03091.1Eucgr.G02398.1
Eucgr.G01642.1
Fragaria vescamrna24405.1-v1.0-hybrid.25.296mrna24405.1-v1.0-hybrid.25.296mrna14926.1-v1.0-hybridmrna05067.1-v1.0-hybridmrna24083.1-v1.0-hybrid.340.611
mrna24083.1-v1.0-hybrid.340.611mrna31897.1-v1.0-hybridmrna24083.1-v1.0-hybrid.40.311mrna24083.1-v1.0-hybrid.40.311mrna15199.1-v1.0-hybrid
mrna04497.1-v1.0-hybridmrna24405.1-v1.0-hybrid.379.638mrna24405.1-v1.0-hybrid.379.638mrna10758.1-v1.0-hybrid
Glycine maxGlyma09g16810.1Glyma02g28880.1Glyma11g07670.1Glyma02g05930.1Glyma16g24610.1
Glyma01g37630.1Glyma19g33080.1Glyma13g16590.1Glyma17g06090.1Glyma14g07730.1
Glyma17g37240.1Glyma03g30180.1Glyma09g02670.1Glyma15g13510.1Glyma09g02610.1
Glyma15g13540.2Glyma15g13540.4Glyma15g13540.3Glyma15g13500.1Glyma09g02600.1
Glyma15g13550.2Glyma09g02680.1Glyma02g15290.1Glyma11g06180.1Glyma07g33180.1
Glyma01g39080.1Glyma15g13560.1Glyma17g06080.2Glyma17g06080.1Glyma09g02590.1
Glyma09g02650.1Glyma07g36580.1Glyma02g15280.1Glyma17g04030.1Glyma16g24640.1
Glyma15g13491.1Glyma09g07550.2Glyma01g40870.1Glyma17g20450.1Glyma01g40870.2.166.342
Glyma01g40870.2.166.342Glyma02g14090.1Glyma01g09650.1Glyma20g04430.2
Gossypium raimondiiGorai.007G049900.1Gorai.007G065200.1Gorai.007G199700.1Gorai.009G198700.1Gorai.006G143400.2
Gorai.006G143400.1Gorai.004G093000.1Gorai.005G068200.1Gorai.004G093200.2Gorai.010G127400.1
Gorai.004G093200.1Gorai.012G150400.1Gorai.007G070800.1Gorai.004G093200.4Gorai.007G238800.4
Gorai.007G238800.3Gorai.007G238800.2Gorai.007G238800.1Gorai.004G265900.2Gorai.004G265900.1
Gorai.008G228500.1Gorai.008G073800.1Gorai.008G174200.1Gorai.005G148900.1
Linum usitatissimumLus10041784Lus10027989Lus10010634Lus10004163Lus10008167
Lus10025535Lus10026748Lus10029094Lus10013065Lus10008168
Lus10008173Lus10020994Lus10027984Lus10027983Lus10017069
Lus10008174Lus10027988Lus10009901Lus10028337Lus10040107
Lus10023858Lus10037786
Malus domesticaMDP0000151864MDP0000312095MDP0000138382MDP0000301828MDP0000245389
MDP0000208152MDP0000706473MDP0000448302MDP0000567775MDP0000215414
MDP0000211003MDP0000233961MDP0000611163MDP0000539299MDP0000208213
MDP0000300218MDP0000727958MDP0000305310MDP0000612477MDP0000581957
MDP0000304104MDP0000292921MDP0000264098
Manihot esculentacassava4.1_011574mcassava4.1_024428mcassava4.1_011738mcassava4.1_032435mcassava4.1_030233m
cassava4.1_023402mcassava4.1_011305mcassava4.1_030160mcassava4.1_011844mcassava4.1_021987m
cassava4.1_011142mcassava4.1_021175mcassava4.1_031396mcassava4.1_013283m
Medicago truncatulaMedtr5g021060.2Medtr8g076820.1Medtr5g021060.1Medtr7g093370.1Medtr2g040000.1
Medtr2g028980.1Medtr2g029740.1Medtr2g029800.2Medtr2g029820.1.136.404Medtr2g029820.1.136.404
Medtr2g029830.1Medtr2g029860.1Medtr2g029820.1.504.772Medtr2g029820.1.504.772Medtr2g029850.1
Medtr2g029750.1Medtr2g029800.1Medtr2g029730.1Medtr1g022970.1AC235668_11.1
Medtr4g122640.1Medtr2g029910.1Medtr5g017850.1Medtr5g017860.1Medtr5g014100.1
Medtr2g029880.1
Mimulus guttatusmgv1a009418mmgv1a009720mmgv1a008931mmgv1a018276mmgv1a009598m
mgv1a018146mmgv1a025866mmgv1a021857mmgv1a024365mmgv1a022021m
Oryza sativaLOC_Os01g15830.1LOC_Os01g36240.1LOC_Os01g15810.1LOC_Os03g13200.1LOC_Os03g13180.1
LOC_Os10g02040.1LOC_Os08g20730.1LOC_Os03g13210.1LOC_Os04g34630.1LOC_Os10g02070.1
LOC_Os06g16350.1
Panicum virgatumPavirv00034835mPavirv00047181mPavirv00048026mPavirv00049606mPavirv00006152m
Pavirv00012630mPavirv00007643mPavirv00049834mPavirv00020708mPavirv00065495m
Pavirv00062710mPavirv00009688mPavirv00060031mPavirv00051769mPavirv00019242m
Pavirv00042223mPavirv00047761mPavirv00012193mPavirv00035893mPavirv00031060m
Pavirv00068439mPavirv00012678mPavirv00052454mPavirv00020296mPavirv00022434m
Pavirv00032381mPavirv00036815mPavirv00022557mPavirv00036818mPavirv00031413m
Pavirv00036817mPavirv00015555mPavirv00056292m
Physcomitrella patensPp1s60_86V6.1Pp1s112_96V6.1
Phaseolus vulgarisPhvul.007G260800.1Phvul.007G260700.1Phvul.001G143300.1Phvul.002G166300.1Phvul.003G257400.1
Phvul.001G011300.1Phvul.006G130000.1Phvul.006G129500.1Phvul.006G129600.1Phvul.006G129900.1
Phvul.003G134600.1Phvul.006G129700.1Phvul.006G129400.1Phvul.003G294000.1Phvul.002G020900.1
Phvul.006G129200.1Phvul.006G129300.1Phvul.006G129800.1Phvul.003G117000.1Phvul.006G130100.1
Phvul.002G005400.1Phvul.002G082100.1Phvul.003G117000.2Phvul.002G005400.2
Picea abiesMA_10227622g0010MA_140596g0010MA_125040g0020MA_10431332g0010MA_20223g0020
MA_10428648g0010MA_109058g0010MA_179122g0010MA_108425g0010MA_10434028g0020
MA_8074461g0010MA_147662g0020MA_111431g0010MA_45356g0010MA_3486g0010
MA_235485g0010MA_10425995g0010MA_120762g0010MA_58726g0010MA_195775g0010
MA_166754g0010MA_10436483g0010.48.237MA_10436483g0010.48.237MA_8977627g0010
Populus trichocarpaPotri.007G019300.1Potri.005G118700.1Potri.003G214500.1Potri.003G214800.1Potri.003G214700.1
Potri.016G058200.1Potri.003G214900.1Potri.001G011200.1Potri.002G031200.1Potri.005G135300.1
Potri.001G011300.1Potri.001G013000.1Potri.008G103200.1Potri.001G011000.1Potri.001G145800.1
Potri.004G144600.1Potri.009G106400.1Potri.016G058800.1Potri.003G215000.1Potri.001G011500.1
Potri.008G110600.1Potri.010G134500.1
Prunus persicappa008390mppa008349mppa007826mppa007654mppb006944m
ppa019052mppa020321mppa008504mppa008433mppa008309m
ppa027053mppa023946mppa008666mppa023689m
Ricinus communis29634.m00206729613.m00038030170.m01409529780.m00132729889.m003322
28295.m00001428691.m00003529676.m00162930054.m00079130138.m003856
Setaria italicaSi002124mSi002126mSi002156mSi002134mSi036541m
Si002053mSi036119mSi007943mSi036449mSi036496m
Si036619mSi036480mSi002076mSi036462mSi036487m
Si036602mSi022700mSi022693mSi022667mSi040875m
Selaginella moellendorffii230146126833235371235372430498
23682222982827135018230396952
91394
Sorghum bicolorSb03g010240.1Sb03g010250.1Sb03g024460.1Sb03g010230.1Sb01g041790.1
Sb01g041770.1Sb01g027330.1Sb06g016610.1Sb07g010450.1Sb01g041760.1
Sb01g020830.1Sb10g010040.1Sb09g020980.1Sb09g021000.1Sb09g020970.1
Sb09g020960.1Sb09g021040.1Sb09g021050.1Sb09g021030.1
Thellungiella halophilaThhalv10022774mThhalv10011616mThhalv10004548mThhalv10014029mThhalv10025683m
Thhalv10013916mThhalv10014080mThhalv10025534mThhalv10016868mThhalv10011077m
Thhalv10011619mThhalv10022759mThhalv10010494mThhalv10028769mThhalv10014083m
Thhalv10016025mThhalv10018830mThhalv10000286mThhalv10016900m
Vitis viniferaGSVIVT01033484001GSVIVT01025373001GSVIVT01034967001GSVIVT01031801001GSVIVT01013238001
GSVIVT01018865001GSVIVT01007448001GSVIVT01010168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)