y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24183.1-v1.0-hybrid
FamilyGH35
Protein PropertiesLength: 829 Molecular Weight: 91609.8 Isoelectric Point: 7.2947
ChromosomeChromosome/Scaffold: 1 Start: 10715215 End: 10725701
Descriptionbeta-galactosidase 10
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH351362321.2e-40
  QWPKKMWPGLVQTAKEGGVDVIETYVFWNGHEPSPGNYYFGGRYDLVKFAKIVEDAGMYLILRIGPFVAAEWYFGGVPVWLHYVPDTVFRTDNEPFK
Full Sequence
Protein Sequence     Length: 829     Download
MKRTCVSAHG APFATVRRRR GRASTPTDSS SVPDHFLSPA SPDRRRGKMI GDAVRVRWGG    60
GAPSSTPKGD ERSSFVRTTD VHSTSFPVHS ILDILSSFCK KKDEGVKTSL AAFFAAVLYI    120
VFGIQCKLRQ ALFDYQWPKK MWPGLVQTAK EGGVDVIETY VFWNGHEPSP GNYYFGGRYD    180
LVKFAKIVED AGMYLILRIG PFVAAEWYFG GVPVWLHYVP DTVFRTDNEP FKIENEYGYY    240
EKDYGEGGKK YAQWSASMAV AQNIGVPWIM CQQFDAPESV YHGGTNFGRT SGGPFITTSY    300
DYEAPIDEYG LPRLPKWAHL KQLHLAIKLC EHILLNSEPT LVPLGPSEEA DVFTNSSGAC    360
AAFISNMDDK NDKTVVFRNV SYHLPAWSVS ILPDCKTEVF NTAKVASQTS VVEMTSETKG    420
LKGLKWEVFV EKAGIWGEAD FFKSGFVDHI NTTRFTTDYL WYTTSIFVDE NEDFLKKGSL    480
PVLQIESKGH ALHAFVNDKL QDSASGNGTH PPFSLKSPIS LKAGKNEIAL LSMTVGLQNA    540
GSFYEWVGAG VTSVKIKGFN NGTIDLSAHN WTYKIGVQGE HLGLYKGDGL SNITWISTAE    600
PPKEQPLTWY KAIVDAPPGD EPIGLDMIHM GKGLAWLNGE EIGRYWPRKS PTHGCVQECN    660
YRGKFDPDKC NTGCGEPTQR WYHVPRSWFK PSGNVLVIFE EKGGNPLKME FSRRKISGAC    720
ALAAVDYPSV DLESWREGNG SNKSISTINL KCPENTHIST VKFASFGNPT GSCGSYTKGD    780
CHDPNSTSVV EKICLHQNNC AIELTEEKFS KGLCSSVTKK LAVEVVCN*                840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin2.0e-1675082781+
pfam01301Glyco_hydro_353.0e-1828132750+
pfam01301Glyco_hydro_358.0e-49138288184+
PLN03059PLN030596.0e-50140280172+
PLN03059PLN030591.0e-180280828554+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A2e-1713823435130A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B8e-1612821620108A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Transmembrane Domains
StartEnd
108125
Hydropathy
Orthologous Group
SpeciesID
Vitis viniferaGSVIVT01022324001GSVIVT01012605001GSVIVT01001735001GSVIVT01003541001GSVIVT01003629001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny