y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24290.1-v1.0-hybrid
FamilyAA1
Protein PropertiesLength: 906 Molecular Weight: 102616 Isoelectric Point: 4.7658
ChromosomeChromosome/Scaffold: 6 Start: 30585059 End: 30590408
Descriptionlaccase 14
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA13258770
  AEVYYHDFIVKEVNFTRLCESKLMLVVNESYPGPAIRARKGDTIYVNVYNQGYYGFTIHWQVPSHNLLFLHGVKQPRNPWFDGPEYVTQCPILPGTNFTY
  QVQLSTEEGTLWWHAHSDWTRASVHGAIVVLPALGTTFPFPEPDEEEIIVFGSWYLGNLKEQVDECLEPATNSNLPIAAGYTVNGRLGDFSPCSKNTTYR
  RKVDYGKTYLLRIVNANIDVEFYFAIAEHNLTVVGLDGSYAKPINTDLIVIAPGQTMDVLLNANSTQGRYYYMVGREYLSATVDTASDDDAIAILEYNGN
  YTTSEAPLFPEQIPDSLSQAPALNFYRKIRSLATPEYPVNVPKESDVTTRMYITASANALYCTEDLGPTCFNISFAASVNNISWANPSESILQAYYKNIS
  EPVYETDFPDEPPVYFNFTEIAMTLDPVLTVQGTKVKVLEYNETVEMVFQGTEVMGGSVNHPMHLHGHSFYVLGFGYGNYFAERDSKTFNLIDPPYVATF
  ITPKNGWLAIRFVANNPGVWFWHCHMERHLTWGMESAFIIKDGGTPETSMLPP
Full Sequence
Protein Sequence     Length: 906     Download
MEDGDAVLKR AHADYGGYEE DVIVDILARL PVKSLMRFRC VCKSWRALIS DPYFVKKHFS    60
WRTETYKLNF NIDPPLFLDL KALKDVKNEV SFKGIDSIML WNPCTRDSKV LSNPPLVIEP    120
KDSNYYYHGF GYDSATDDYK VMRGFAYDAN GAEKFMTQIF ALKTGSWRTV KDIDYVELTE    180
GQGVFLNGAL HWLGDLSDGD RKILSFDLGA EKFQETIPLP YDDWFTDLLI HRNRLCVCTR    240
PTKSNSCHIW MMKEYGVKES WTELVQFSLD NYVWGPEDHR HYVSPVCILE NGVVLIDGLG    300
CYEWLMFAVF AVLIILKVLI SLAQAEVYYH DFIVKEVNFT RLCESKLMLV VNESYPGPAI    360
RARKGDTIYV NVYNQGYYGF TIHWQVPSHN LLFLHGVKQP RNPWFDGPEY VTQCPILPGT    420
NFTYQVQLST EEGTLWWHAH SDWTRASVHG AIVVLPALGT TFPFPEPDEE EIIVFGSWYL    480
GNLKEQVDEC LEPATNSNLP IAAGYTVNGR LGDFSPCSKN TTYRRKVDYG KTYLLRIVNA    540
NIDVEFYFAI AEHNLTVVGL DGSYAKPINT DLIVIAPGQT MDVLLNANST QGRYYYMVGR    600
EYLSATVDTA SDDDAIAILE YNGNYTTSEA PLFPEQIPDS LSQAPALNFY RKIRSLATPE    660
YPVNVPKESD VTTRMYITAS ANALYCTEDL GPTCFNISFA ASVNNISWAN PSESILQAYY    720
KNISEPVYET DFPDEPPVYF NFTEIAMTLD PVLTVQGTKV KVLEYNETVE MVFQGTEVMG    780
GSVNHPMHLH GHSFYVLGFG YGNYFAERDS KTFNLIDPPY VATFITPKNG WLAIRFVANN    840
PGVWFWHCHM ERHLTWGMES AFIIKDGGTP ETSMLPPPAT MPSCDVPLDS ATLPSNSELN    900
KNQIE*                                                               960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_34.0e-42334456125+
PLN02191PLN021911.0e-55309863584+
PLN02604PLN026043.0e-64307874600+
TIGR03388ascorbase6.0e-69343862552+
TIGR03389laccase0325884562+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0005515protein binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B03258621521A Chain A, Structure Of Human Haspin Kinase Domain
PDB1asq_A03258621521A Chain A, Structure Of Human Haspin Kinase Domain
PDB1asp_B03258621521A Chain A, Structure Of Human Haspin Kinase Domain
PDB1asp_A03258621521A Chain A, Structure Of Human Haspin Kinase Domain
PDB1aso_B03258621521A Chain A, Structure Of Human Haspin Kinase Domain
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna27522.1-v1.0-hybridmrna17621.1-v1.0-hybrid
mrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybridmrna02152.1-v1.0-hybrid
mrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)